Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilL   Type   Machinery gene
Locus tag   Q7644_RS02385 Genome accession   NZ_CP131645
Coordinates   449455..449928 (+) Length   157 a.a.
NCBI ID   WP_012503482.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 2004S05-027     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 449998..501487 449455..449928 flank 70


Gene organization within MGE regions


Location: 449455..501487
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7644_RS02385 (Q7644_02395) pilL 449455..449928 (+) 474 WP_012503482.1 PilX family type IV pilin Machinery gene
  Q7644_RS02390 (Q7644_02400) - 449998..450306 (-) 309 WP_003706588.1 AzlD family protein -
  Q7644_RS02395 (Q7644_02405) - 450303..451014 (-) 712 Protein_467 AzlC family ABC transporter permease -
  Q7644_RS02400 (Q7644_02410) dut 451180..451632 (+) 453 WP_003701071.1 dUTP diphosphatase -
  Q7644_RS02405 (Q7644_02415) dapC 451704..452891 (+) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  Q7644_RS02410 (Q7644_02420) yaaA 453047..453826 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  Q7644_RS02425 (Q7644_02435) - 454356..455556 (+) 1201 Protein_471 integrase arm-type DNA-binding domain-containing protein -
  Q7644_RS02430 (Q7644_02440) - 455912..456181 (-) 270 WP_003687928.1 hypothetical protein -
  Q7644_RS02435 (Q7644_02445) - 456376..457059 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  Q7644_RS02440 - 457373..457606 (-) 234 Protein_474 hypothetical protein -
  Q7644_RS02445 (Q7644_02455) - 457717..457932 (-) 216 WP_003691538.1 hypothetical protein -
  Q7644_RS02450 (Q7644_02460) - 457984..458475 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  Q7644_RS02455 (Q7644_02465) - 458472..458654 (-) 183 WP_003691535.1 hypothetical protein -
  Q7644_RS02460 (Q7644_02470) - 458794..459480 (-) 687 WP_082278088.1 hypothetical protein -
  Q7644_RS02465 (Q7644_02475) - 459549..459710 (-) 162 WP_003691530.1 hypothetical protein -
  Q7644_RS02470 (Q7644_02480) - 459707..459985 (-) 279 WP_041421244.1 hypothetical protein -
  Q7644_RS02475 (Q7644_02485) - 460138..460470 (-) 333 WP_003695500.1 hypothetical protein -
  Q7644_RS02480 (Q7644_02490) - 460611..460910 (-) 300 WP_341931124.1 hypothetical protein -
  Q7644_RS02485 (Q7644_02495) - 460907..461383 (-) 477 WP_002255718.1 hypothetical protein -
  Q7644_RS02490 (Q7644_02500) - 461416..461616 (-) 201 WP_047917349.1 hypothetical protein -
  Q7644_RS02495 (Q7644_02505) - 462100..462318 (+) 219 WP_003691731.1 hypothetical protein -
  Q7644_RS02500 (Q7644_02510) - 462335..462694 (-) 360 WP_003691733.1 hypothetical protein -
  Q7644_RS02505 (Q7644_02515) - 462695..463234 (-) 540 WP_003695998.1 type II toxin-antitoxin system antitoxin SocA domain-containing protein -
  Q7644_RS02510 (Q7644_02520) - 463394..464110 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  Q7644_RS02515 (Q7644_02525) - 464491..464718 (+) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  Q7644_RS02520 (Q7644_02530) - 464715..465755 (+) 1041 WP_341931125.1 helix-turn-helix domain-containing protein -
  Q7644_RS02525 (Q7644_02535) - 465767..466546 (+) 780 WP_041421353.1 ATP-binding protein -
  Q7644_RS02530 (Q7644_02540) - 466559..466822 (+) 264 WP_218422957.1 hypothetical protein -
  Q7644_RS02535 (Q7644_02545) - 466861..467355 (+) 495 WP_041421248.1 DUF3310 domain-containing protein -
  Q7644_RS02540 (Q7644_02550) - 467530..467679 (+) 150 WP_041421445.1 hypothetical protein -
  Q7644_RS02545 (Q7644_02555) - 467757..467990 (+) 234 WP_047919779.1 hypothetical protein -
  Q7644_RS02550 (Q7644_02560) - 467981..468361 (+) 381 WP_041421299.1 RusA family crossover junction endodeoxyribonuclease -
  Q7644_RS02555 (Q7644_02565) - 468378..468506 (-) 129 WP_012503747.1 hypothetical protein -
  Q7644_RS02560 (Q7644_02570) - 468628..469035 (+) 408 WP_003691430.1 hypothetical protein -
  Q7644_RS02565 (Q7644_02575) - 469126..470148 (+) 1023 WP_229684527.1 type I restriction endonuclease -
  Q7644_RS02570 (Q7644_02580) - 470370..470819 (+) 450 WP_003695485.1 hypothetical protein -
  Q7644_RS02575 (Q7644_02585) terL 470881..472302 (+) 1422 WP_003697216.1 phage terminase large subunit -
  Q7644_RS02580 (Q7644_02590) - 472299..474446 (+) 2148 WP_003691423.1 phage portal protein -
  Q7644_RS02585 (Q7644_02595) - 474514..475671 (+) 1158 WP_010360058.1 HK97 family phage prohead protease -
  Q7644_RS02590 (Q7644_02600) - 475712..477211 (+) 1500 WP_003689084.1 hypothetical protein -
  Q7644_RS02595 (Q7644_02605) - 477218..477580 (+) 363 WP_003689082.1 hypothetical protein -
  Q7644_RS02600 (Q7644_02610) - 477583..478113 (+) 531 WP_003689080.1 head-tail connector protein -
  Q7644_RS02605 (Q7644_02615) - 478113..478595 (+) 483 WP_003703855.1 HK97 gp10 family phage protein -
  Q7644_RS02610 (Q7644_02620) - 478592..479020 (+) 429 WP_003697213.1 hypothetical protein -
  Q7644_RS02615 (Q7644_02625) - 479046..479819 (+) 774 WP_003692869.1 hypothetical protein -
  Q7644_RS02620 (Q7644_02630) - 479880..480209 (+) 330 WP_003689072.1 hypothetical protein -
  Q7644_RS02625 (Q7644_02635) - 480221..480487 (+) 267 WP_003689070.1 hypothetical protein -
  Q7644_RS02630 (Q7644_02640) - 480487..481086 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  Q7644_RS02635 (Q7644_02645) - 481083..481937 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  Q7644_RS02640 (Q7644_02650) - 481939..482370 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  Q7644_RS02645 (Q7644_02655) - 482398..482676 (-) 279 WP_003689062.1 XRE family transcriptional regulator -
  Q7644_RS02650 (Q7644_02660) - 482916..487058 (+) 4143 WP_341931126.1 phage tail protein -
  Q7644_RS02655 (Q7644_02665) - 487170..487475 (+) 306 WP_003689058.1 hypothetical protein -
  Q7644_RS02660 (Q7644_02670) - 487546..488016 (+) 471 WP_003691410.1 hypothetical protein -
  Q7644_RS02665 (Q7644_02675) - 488017..488349 (+) 333 WP_003691408.1 hypothetical protein -
  Q7644_RS02670 (Q7644_02680) - 488508..488660 (+) 153 WP_014580252.1 hypothetical protein -
  Q7644_RS02675 (Q7644_02685) - 488715..489062 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  Q7644_RS02680 (Q7644_02690) - 489062..489298 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  Q7644_RS02685 (Q7644_02695) - 489338..489463 (+) 126 WP_255294325.1 hypothetical protein -
  Q7644_RS02690 (Q7644_02700) - 489505..490044 (+) 540 WP_003695466.1 TIGR02594 family protein -
  Q7644_RS02695 (Q7644_02705) - 490045..490389 (+) 345 WP_003695464.1 hypothetical protein -
  Q7644_RS02700 (Q7644_02710) - 490858..491007 (+) 150 WP_003691402.1 hypothetical protein -
  Q7644_RS02705 (Q7644_02715) - 491037..494081 (+) 3045 WP_341931128.1 tape measure protein -
  Q7644_RS02710 (Q7644_02720) - 494141..494620 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  Q7644_RS02715 (Q7644_02725) - 494962..495951 (-) 990 WP_003689040.1 site-specific integrase -
  Q7644_RS02720 (Q7644_02730) - 496211..496399 (-) 189 WP_003689039.1 hypothetical protein -
  Q7644_RS02725 (Q7644_02735) purM 496640..497674 (+) 1035 WP_047923885.1 phosphoribosylformylglycinamidine cyclo-ligase -
  Q7644_RS02730 (Q7644_02740) - 497892..498197 (+) 306 WP_115176813.1 hypothetical protein -
  Q7644_RS02735 (Q7644_02745) - 498673..499326 (+) 654 WP_341931129.1 IS1595 family transposase -
  Q7644_RS02740 (Q7644_02750) - 499460..501487 (+) 2028 WP_047918857.1 BCCT family transporter -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17486.30 Da        Isoelectric Point: 9.9561

>NTDB_id=863215 Q7644_RS02385 WP_012503482.1 449455..449928(+) (pilL) [Neisseria gonorrhoeae strain 2004S05-027]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQIIKSKLETFVLGYKM
NPKIAKKYSVSVAFANTEKPRAYRLVGVPKAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK

Nucleotide


Download         Length: 474 bp        

>NTDB_id=863215 Q7644_RS02385 WP_012503482.1 449455..449928(+) (pilL) [Neisseria gonorrhoeae strain 2004S05-027]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGATCATCAAGAGCAAACTGGAAACATTTGTCTTAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGCATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(3-25)

Minor type IV pilin, PilX (Pilin_PilX)

(31-157)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilL Neisseria gonorrhoeae MS11

91.72

100

0.917
  pilX Neisseria meningitidis 8013

85.35

100

0.854