Detailed information
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | Q7649_RS02700 | Genome accession | NZ_CP131630 |
| Coordinates | 519676..520149 (+) | Length | 157 a.a. |
| NCBI ID | WP_025455782.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 2018C07-301 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 505197..557866 | 519676..520149 | within | 0 |
Gene organization within MGE regions
Location: 505197..557866
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q7649_RS02625 (Q7649_02620) | - | 505197..506180 (+) | 984 | WP_003687900.1 | ribose-phosphate pyrophosphokinase | - |
| Q7649_RS02630 (Q7649_02625) | - | 506247..506819 (+) | 573 | WP_003687901.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| Q7649_RS02635 (Q7649_02630) | - | 506945..508114 (-) | 1170 | WP_003690889.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| Q7649_RS02640 (Q7649_02635) | ilvA | 508263..509789 (+) | 1527 | WP_003690890.1 | threonine ammonia-lyase, biosynthetic | - |
| Q7649_RS02645 (Q7649_02640) | - | 509845..510921 (-) | 1077 | WP_003687905.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| Q7649_RS02650 (Q7649_02645) | cysW | 510918..511778 (-) | 861 | WP_003690891.1 | sulfate ABC transporter permease subunit CysW | - |
| Q7649_RS02655 (Q7649_02650) | cysT | 511967..512796 (-) | 830 | Protein_512 | sulfate ABC transporter permease subunit CysT | - |
| Q7649_RS02660 (Q7649_02655) | - | 512982..513314 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| Q7649_RS02665 (Q7649_02660) | - | 513644..514153 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| Q7649_RS02670 (Q7649_02665) | - | 514385..514966 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| Q7649_RS02675 (Q7649_02670) | dnaB | 515130..516536 (+) | 1407 | WP_003690896.1 | replicative DNA helicase | - |
| Q7649_RS02680 (Q7649_02675) | pilH | 516844..517509 (+) | 666 | WP_003690897.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| Q7649_RS02685 (Q7649_02680) | pilI | 517541..518149 (+) | 609 | WP_003690898.1 | type IV pilus modification protein PilV | Machinery gene |
| Q7649_RS02690 (Q7649_02685) | pilJ | 518146..519087 (+) | 942 | WP_003690899.1 | PilW family protein | Machinery gene |
| Q7649_RS02695 (Q7649_02690) | pilK | 519066..519674 (+) | 609 | WP_003690900.1 | pilus assembly protein | Machinery gene |
| Q7649_RS02700 (Q7649_02695) | pilL | 519676..520149 (+) | 474 | WP_025455782.1 | PilX family type IV pilin | Machinery gene |
| Q7649_RS02705 (Q7649_02700) | - | 520761..521206 (-) | 446 | Protein_522 | AzlC family ABC transporter permease | - |
| Q7649_RS02710 (Q7649_02705) | dut | 521372..521824 (+) | 453 | WP_003690909.1 | dUTP diphosphatase | - |
| Q7649_RS02715 (Q7649_02710) | dapC | 521902..523089 (+) | 1188 | WP_003690911.1 | succinyldiaminopimelate transaminase | - |
| Q7649_RS02720 (Q7649_02715) | yaaA | 523245..524024 (+) | 780 | WP_003690913.1 | peroxide stress protein YaaA | - |
| Q7649_RS02735 (Q7649_02730) | - | 524555..525751 (+) | 1197 | WP_003704323.1 | integrase arm-type DNA-binding domain-containing protein | - |
| Q7649_RS02740 (Q7649_02735) | - | 526107..526376 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| Q7649_RS02745 (Q7649_02740) | - | 526571..527254 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| Q7649_RS02750 | - | 527568..527801 (-) | 234 | Protein_529 | hypothetical protein | - |
| Q7649_RS02755 (Q7649_02750) | - | 527912..528127 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| Q7649_RS02760 (Q7649_02755) | - | 528179..528670 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| Q7649_RS02765 (Q7649_02760) | - | 528667..528849 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| Q7649_RS02770 (Q7649_02765) | - | 528989..529675 (-) | 687 | WP_003691532.1 | hypothetical protein | - |
| Q7649_RS02775 (Q7649_02770) | - | 529744..529905 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| Q7649_RS02780 (Q7649_02775) | - | 529902..530180 (-) | 279 | WP_003691529.1 | hypothetical protein | - |
| Q7649_RS02785 (Q7649_02780) | - | 530333..530665 (-) | 333 | WP_003691528.1 | hypothetical protein | - |
| Q7649_RS02790 (Q7649_02785) | - | 530806..531093 (-) | 288 | WP_115067298.1 | hypothetical protein | - |
| Q7649_RS02795 (Q7649_02790) | - | 531090..531566 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| Q7649_RS02800 (Q7649_02795) | - | 531599..531799 (-) | 201 | WP_003704298.1 | hypothetical protein | - |
| Q7649_RS02805 (Q7649_02800) | - | 531997..532410 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| Q7649_RS02810 (Q7649_02805) | - | 532407..532868 (-) | 462 | WP_003687965.1 | helix-turn-helix transcriptional regulator | - |
| Q7649_RS02815 (Q7649_02810) | - | 532885..533322 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| Q7649_RS02820 (Q7649_02815) | - | 533437..534153 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| Q7649_RS02825 (Q7649_02820) | - | 534222..534458 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| Q7649_RS02830 (Q7649_02825) | - | 534538..534693 (+) | 156 | WP_047923772.1 | hypothetical protein | - |
| Q7649_RS02835 (Q7649_02830) | - | 534670..534858 (-) | 189 | WP_047926457.1 | hypothetical protein | - |
| Q7649_RS02840 (Q7649_02835) | - | 535032..535259 (+) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| Q7649_RS02845 (Q7649_02840) | - | 535256..536281 (+) | 1026 | WP_144858286.1 | helix-turn-helix domain-containing protein | - |
| Q7649_RS02850 (Q7649_02845) | - | 536294..537076 (+) | 783 | WP_033910919.1 | ATP-binding protein | - |
| Q7649_RS02855 (Q7649_02850) | - | 537089..537352 (+) | 264 | WP_341986399.1 | hypothetical protein | - |
| Q7649_RS02860 (Q7649_02855) | - | 537391..537846 (+) | 456 | WP_050164337.1 | DUF3310 domain-containing protein | - |
| Q7649_RS02865 (Q7649_02860) | - | 537870..538019 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| Q7649_RS02870 (Q7649_02865) | - | 538049..538318 (+) | 270 | WP_047921130.1 | hypothetical protein | - |
| Q7649_RS02875 (Q7649_02870) | - | 538309..538746 (+) | 438 | WP_047918627.1 | RusA family crossover junction endodeoxyribonuclease | - |
| Q7649_RS02880 (Q7649_02875) | - | 538739..539044 (+) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| Q7649_RS02885 (Q7649_02880) | - | 539041..539424 (+) | 384 | WP_003690918.1 | recombination protein NinB | - |
| Q7649_RS02890 (Q7649_02885) | - | 539415..539933 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| Q7649_RS02895 (Q7649_02890) | - | 539998..540420 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| Q7649_RS02900 (Q7649_02895) | - | 540420..540959 (+) | 540 | WP_003690920.1 | hypothetical protein | - |
| Q7649_RS02905 (Q7649_02900) | - | 540940..542214 (+) | 1275 | WP_014580143.1 | PBSX family phage terminase large subunit | - |
| Q7649_RS02910 (Q7649_02905) | - | 542199..544466 (+) | 2268 | WP_225577699.1 | hypothetical protein | - |
| Q7649_RS02915 (Q7649_02910) | - | 544702..545898 (+) | 1197 | WP_003690925.1 | hypothetical protein | - |
| Q7649_RS02920 (Q7649_02915) | - | 545895..547109 (+) | 1215 | WP_047954539.1 | hypothetical protein | - |
| Q7649_RS02925 (Q7649_02920) | - | 550003..553107 (+) | 3105 | Protein_564 | PLxRFG domain-containing protein | - |
| Q7649_RS02930 (Q7649_02925) | - | 553089..553826 (+) | 738 | WP_003690932.1 | hypothetical protein | - |
| Q7649_RS02935 (Q7649_02930) | - | 553847..555142 (+) | 1296 | WP_003690933.1 | DUF4043 family protein | - |
| Q7649_RS02940 (Q7649_02935) | - | 555197..555670 (+) | 474 | WP_003690936.1 | hypothetical protein | - |
| Q7649_RS02945 (Q7649_02940) | - | 555676..556161 (+) | 486 | WP_003687997.1 | hypothetical protein | - |
| Q7649_RS02950 (Q7649_02945) | - | 556158..556832 (+) | 675 | WP_003687998.1 | hypothetical protein | - |
| Q7649_RS02955 (Q7649_02950) | - | 556823..556984 (+) | 162 | WP_003687999.1 | hypothetical protein | - |
| Q7649_RS02960 (Q7649_02955) | - | 557021..557866 (-) | 846 | WP_003690940.1 | BRO family protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17506.38 Da Isoelectric Point: 9.8238
>NTDB_id=862980 Q7649_RS02700 WP_025455782.1 519676..520149(+) (pilL) [Neisseria gonorrhoeae strain 2018C07-301]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNVGTGYTLSVWMNSVGDGYKCRDAASAKAYKEQLSGDGGCEALSNRKK
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDNNQTIKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNVGTGYTLSVWMNSVGDGYKCRDAASAKAYKEQLSGDGGCEALSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=862980 Q7649_RS02700 WP_025455782.1 519676..520149(+) (pilL) [Neisseria gonorrhoeae strain 2018C07-301]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGTGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGGCCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACAATAATCAGACCATCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGTGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCGGCAAAGGCCTATAAAGAGCAGTTGTCCGGAGACGGTGGTTGTGAAGCCTTATCCAACCGTAAGAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
89.172 |
100 |
0.892 |
| pilX | Neisseria meningitidis 8013 |
85.987 |
100 |
0.86 |