Detailed information    

insolico Bioinformatically predicted

Overview

Name   pilH   Type   Machinery gene
Locus tag   Q7649_RS02680 Genome accession   NZ_CP131630
Coordinates   516844..517509 (+) Length   221 a.a.
NCBI ID   WP_003690897.1    Uniprot ID   A0AB74EDV3
Organism   Neisseria gonorrhoeae strain 2018C07-301     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 505197..557866 516844..517509 within 0


Gene organization within MGE regions


Location: 505197..557866
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q7649_RS02625 (Q7649_02620) - 505197..506180 (+) 984 WP_003687900.1 ribose-phosphate pyrophosphokinase -
  Q7649_RS02630 (Q7649_02625) - 506247..506819 (+) 573 WP_003687901.1 50S ribosomal protein L25/general stress protein Ctc -
  Q7649_RS02635 (Q7649_02630) - 506945..508114 (-) 1170 WP_003690889.1 D-alanyl-D-alanine carboxypeptidase family protein -
  Q7649_RS02640 (Q7649_02635) ilvA 508263..509789 (+) 1527 WP_003690890.1 threonine ammonia-lyase, biosynthetic -
  Q7649_RS02645 (Q7649_02640) - 509845..510921 (-) 1077 WP_003687905.1 sulfate/molybdate ABC transporter ATP-binding protein -
  Q7649_RS02650 (Q7649_02645) cysW 510918..511778 (-) 861 WP_003690891.1 sulfate ABC transporter permease subunit CysW -
  Q7649_RS02655 (Q7649_02650) cysT 511967..512796 (-) 830 Protein_512 sulfate ABC transporter permease subunit CysT -
  Q7649_RS02660 (Q7649_02655) - 512982..513314 (+) 333 WP_003687908.1 hypothetical protein -
  Q7649_RS02665 (Q7649_02660) - 513644..514153 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  Q7649_RS02670 (Q7649_02665) - 514385..514966 (-) 582 WP_003690895.1 superoxide dismutase -
  Q7649_RS02675 (Q7649_02670) dnaB 515130..516536 (+) 1407 WP_003690896.1 replicative DNA helicase -
  Q7649_RS02680 (Q7649_02675) pilH 516844..517509 (+) 666 WP_003690897.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  Q7649_RS02685 (Q7649_02680) pilI 517541..518149 (+) 609 WP_003690898.1 type IV pilus modification protein PilV Machinery gene
  Q7649_RS02690 (Q7649_02685) pilJ 518146..519087 (+) 942 WP_003690899.1 PilW family protein Machinery gene
  Q7649_RS02695 (Q7649_02690) pilK 519066..519674 (+) 609 WP_003690900.1 pilus assembly protein Machinery gene
  Q7649_RS02700 (Q7649_02695) pilL 519676..520149 (+) 474 WP_025455782.1 PilX family type IV pilin Machinery gene
  Q7649_RS02705 (Q7649_02700) - 520761..521206 (-) 446 Protein_522 AzlC family ABC transporter permease -
  Q7649_RS02710 (Q7649_02705) dut 521372..521824 (+) 453 WP_003690909.1 dUTP diphosphatase -
  Q7649_RS02715 (Q7649_02710) dapC 521902..523089 (+) 1188 WP_003690911.1 succinyldiaminopimelate transaminase -
  Q7649_RS02720 (Q7649_02715) yaaA 523245..524024 (+) 780 WP_003690913.1 peroxide stress protein YaaA -
  Q7649_RS02735 (Q7649_02730) - 524555..525751 (+) 1197 WP_003704323.1 integrase arm-type DNA-binding domain-containing protein -
  Q7649_RS02740 (Q7649_02735) - 526107..526376 (-) 270 WP_003687928.1 hypothetical protein -
  Q7649_RS02745 (Q7649_02740) - 526571..527254 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  Q7649_RS02750 - 527568..527801 (-) 234 Protein_529 hypothetical protein -
  Q7649_RS02755 (Q7649_02750) - 527912..528127 (-) 216 WP_003691538.1 hypothetical protein -
  Q7649_RS02760 (Q7649_02755) - 528179..528670 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  Q7649_RS02765 (Q7649_02760) - 528667..528849 (-) 183 WP_003691535.1 hypothetical protein -
  Q7649_RS02770 (Q7649_02765) - 528989..529675 (-) 687 WP_003691532.1 hypothetical protein -
  Q7649_RS02775 (Q7649_02770) - 529744..529905 (-) 162 WP_003691530.1 hypothetical protein -
  Q7649_RS02780 (Q7649_02775) - 529902..530180 (-) 279 WP_003691529.1 hypothetical protein -
  Q7649_RS02785 (Q7649_02780) - 530333..530665 (-) 333 WP_003691528.1 hypothetical protein -
  Q7649_RS02790 (Q7649_02785) - 530806..531093 (-) 288 WP_115067298.1 hypothetical protein -
  Q7649_RS02795 (Q7649_02790) - 531090..531566 (-) 477 WP_002255718.1 hypothetical protein -
  Q7649_RS02800 (Q7649_02795) - 531599..531799 (-) 201 WP_003704298.1 hypothetical protein -
  Q7649_RS02805 (Q7649_02800) - 531997..532410 (-) 414 WP_003687963.1 hypothetical protein -
  Q7649_RS02810 (Q7649_02805) - 532407..532868 (-) 462 WP_003687965.1 helix-turn-helix transcriptional regulator -
  Q7649_RS02815 (Q7649_02810) - 532885..533322 (-) 438 WP_003687967.1 hypothetical protein -
  Q7649_RS02820 (Q7649_02815) - 533437..534153 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  Q7649_RS02825 (Q7649_02820) - 534222..534458 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  Q7649_RS02830 (Q7649_02825) - 534538..534693 (+) 156 WP_047923772.1 hypothetical protein -
  Q7649_RS02835 (Q7649_02830) - 534670..534858 (-) 189 WP_047926457.1 hypothetical protein -
  Q7649_RS02840 (Q7649_02835) - 535032..535259 (+) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  Q7649_RS02845 (Q7649_02840) - 535256..536281 (+) 1026 WP_144858286.1 helix-turn-helix domain-containing protein -
  Q7649_RS02850 (Q7649_02845) - 536294..537076 (+) 783 WP_033910919.1 ATP-binding protein -
  Q7649_RS02855 (Q7649_02850) - 537089..537352 (+) 264 WP_341986399.1 hypothetical protein -
  Q7649_RS02860 (Q7649_02855) - 537391..537846 (+) 456 WP_050164337.1 DUF3310 domain-containing protein -
  Q7649_RS02865 (Q7649_02860) - 537870..538019 (+) 150 WP_003689110.1 hypothetical protein -
  Q7649_RS02870 (Q7649_02865) - 538049..538318 (+) 270 WP_047921130.1 hypothetical protein -
  Q7649_RS02875 (Q7649_02870) - 538309..538746 (+) 438 WP_047918627.1 RusA family crossover junction endodeoxyribonuclease -
  Q7649_RS02880 (Q7649_02875) - 538739..539044 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  Q7649_RS02885 (Q7649_02880) - 539041..539424 (+) 384 WP_003690918.1 recombination protein NinB -
  Q7649_RS02890 (Q7649_02885) - 539415..539933 (+) 519 WP_003687984.1 HNH endonuclease -
  Q7649_RS02895 (Q7649_02890) - 539998..540420 (+) 423 WP_003690919.1 hypothetical protein -
  Q7649_RS02900 (Q7649_02895) - 540420..540959 (+) 540 WP_003690920.1 hypothetical protein -
  Q7649_RS02905 (Q7649_02900) - 540940..542214 (+) 1275 WP_014580143.1 PBSX family phage terminase large subunit -
  Q7649_RS02910 (Q7649_02905) - 542199..544466 (+) 2268 WP_225577699.1 hypothetical protein -
  Q7649_RS02915 (Q7649_02910) - 544702..545898 (+) 1197 WP_003690925.1 hypothetical protein -
  Q7649_RS02920 (Q7649_02915) - 545895..547109 (+) 1215 WP_047954539.1 hypothetical protein -
  Q7649_RS02925 (Q7649_02920) - 550003..553107 (+) 3105 Protein_564 PLxRFG domain-containing protein -
  Q7649_RS02930 (Q7649_02925) - 553089..553826 (+) 738 WP_003690932.1 hypothetical protein -
  Q7649_RS02935 (Q7649_02930) - 553847..555142 (+) 1296 WP_003690933.1 DUF4043 family protein -
  Q7649_RS02940 (Q7649_02935) - 555197..555670 (+) 474 WP_003690936.1 hypothetical protein -
  Q7649_RS02945 (Q7649_02940) - 555676..556161 (+) 486 WP_003687997.1 hypothetical protein -
  Q7649_RS02950 (Q7649_02945) - 556158..556832 (+) 675 WP_003687998.1 hypothetical protein -
  Q7649_RS02955 (Q7649_02950) - 556823..556984 (+) 162 WP_003687999.1 hypothetical protein -
  Q7649_RS02960 (Q7649_02955) - 557021..557866 (-) 846 WP_003690940.1 BRO family protein -

Sequence

Protein


Download         Length: 221 a.a.        Molecular weight: 24613.05 Da        Isoelectric Point: 9.4066

>NTDB_id=862976 Q7649_RS02680 WP_003690897.1 516844..517509(+) (pilH) [Neisseria gonorrhoeae strain 2018C07-301]
MCTRKQQGFTLIELLIVIAIAAIMATIALPNMSGWIASRRIASHAEQVANLLRFSRGEAVRLNLPVYICPAQVKKDGTVD
NQCDLGKKEQGMLAFGDKNDNKAYDGDSADVFLRNVVLNDDIKDKRINYTFNHIAFGQTRSTADRVVWTFNQNGTFGYSS
DRNLKNNSKFVYSDGYIQIVLTDAKAVSAGEKKFRSAVVLIDSSGRVEVCPRNDRRAVCQH

Nucleotide


Download         Length: 666 bp        

>NTDB_id=862976 Q7649_RS02680 WP_003690897.1 516844..517509(+) (pilH) [Neisseria gonorrhoeae strain 2018C07-301]
ATGTGTACACGAAAACAACAAGGTTTCACGCTAATAGAGCTGCTCATCGTGATAGCCATTGCAGCCATTATGGCGACGAT
AGCCCTCCCCAATATGAGTGGGTGGATTGCATCACGCCGCATTGCCAGTCACGCGGAGCAGGTTGCCAACCTTTTGCGTT
TCTCCAGGGGCGAAGCCGTCCGGCTCAATCTCCCTGTCTATATCTGTCCTGCCCAAGTTAAAAAAGACGGTACGGTCGAC
AACCAATGCGACTTGGGTAAGAAGGAACAGGGGATGTTGGCTTTCGGCGACAAAAACGACAATAAGGCATATGACGGTGA
TTCTGCGGATGTTTTTCTCCGTAACGTGGTATTGAATGATGATATCAAGGATAAGCGGATTAATTACACCTTCAATCATA
TCGCTTTCGGTCAAACACGGTCGACTGCCGATCGTGTTGTTTGGACTTTCAACCAAAACGGGACATTCGGCTATTCGTCC
GATCGGAATCTCAAGAATAATTCCAAATTTGTTTATTCTGACGGTTATATCCAAATCGTGTTGACAGATGCGAAGGCGGT
TTCTGCCGGTGAAAAGAAATTCCGTTCGGCGGTGGTTTTGATTGACAGCAGCGGCAGGGTCGAAGTTTGCCCTAGAAACG
ATAGGCGTGCCGTATGCCAACATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(4-29)

Type II transport protein GspH (GspH)

(44-205)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilH Neisseria gonorrhoeae MS11

82.805

100

0.828