Detailed information
Overview
| Name | comE | Type | Machinery gene |
| Locus tag | Q6379_RS08460 | Genome accession | NZ_CP130892 |
| Coordinates | 1607770..1608165 (-) | Length | 131 a.a. |
| NCBI ID | WP_003703428.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain NJ204705 | ||
| Function | DNA binding (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1575922..1606983 | 1607770..1608165 | flank | 787 |
Gene organization within MGE regions
Location: 1575922..1608165
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q6379_RS08205 (Q6379_08205) | - | 1575950..1576924 (-) | 975 | WP_003689550.1 | SIS domain-containing protein | - |
| Q6379_RS08210 (Q6379_08210) | tal | 1577021..1578076 (+) | 1056 | WP_003689551.1 | transaldolase | - |
| Q6379_RS08215 (Q6379_08215) | - | 1578088..1578222 (+) | 135 | WP_012503902.1 | hypothetical protein | - |
| Q6379_RS08220 (Q6379_08220) | - | 1578227..1578517 (+) | 291 | WP_003689553.1 | hypothetical protein | - |
| Q6379_RS08225 (Q6379_08225) | gluQRS | 1578534..1579421 (+) | 888 | WP_003689554.1 | tRNA glutamyl-Q(34) synthetase GluQRS | - |
| Q6379_RS08230 (Q6379_08230) | dusA | 1579491..1580507 (-) | 1017 | WP_003689555.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| Q6379_RS08235 (Q6379_08235) | - | 1580627..1581781 (+) | 1155 | WP_003697468.1 | tyrosine-type recombinase/integrase | - |
| Q6379_RS08240 (Q6379_08240) | - | 1581831..1582097 (-) | 267 | WP_003689557.1 | pyocin activator PrtN family protein | - |
| Q6379_RS08245 (Q6379_08245) | - | 1582205..1583152 (-) | 948 | WP_012503904.1 | hypothetical protein | - |
| Q6379_RS08250 (Q6379_08250) | - | 1583124..1583354 (-) | 231 | WP_003695893.1 | hypothetical protein | - |
| Q6379_RS08255 (Q6379_08255) | - | 1583351..1584334 (-) | 984 | WP_047952517.1 | hypothetical protein | - |
| Q6379_RS08260 (Q6379_08260) | - | 1584445..1584660 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| Q6379_RS08265 (Q6379_08265) | - | 1584712..1585203 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| Q6379_RS08270 (Q6379_08270) | - | 1585200..1585382 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| Q6379_RS08275 (Q6379_08275) | - | 1585522..1586208 (-) | 687 | WP_042758540.1 | phage replication initiation protein, NGO0469 family | - |
| Q6379_RS08280 (Q6379_08280) | - | 1586277..1586438 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| Q6379_RS08285 (Q6379_08285) | - | 1586435..1586710 (-) | 276 | WP_003703838.1 | NGO1622 family putative holin | - |
| Q6379_RS08290 (Q6379_08290) | - | 1586864..1587196 (-) | 333 | WP_003696914.1 | hypothetical protein | - |
| Q6379_RS08295 (Q6379_08295) | - | 1587337..1587624 (-) | 288 | WP_304672913.1 | hypothetical protein | - |
| Q6379_RS08300 (Q6379_08300) | - | 1587621..1588097 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| Q6379_RS08305 (Q6379_08305) | - | 1588130..1588330 (-) | 201 | WP_047954343.1 | hypothetical protein | - |
| Q6379_RS08310 (Q6379_08310) | - | 1588814..1589032 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| Q6379_RS08315 (Q6379_08315) | - | 1589049..1589408 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| Q6379_RS08320 (Q6379_08320) | - | 1589409..1589948 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| Q6379_RS08325 (Q6379_08325) | - | 1590108..1590824 (-) | 717 | WP_003695999.1 | helix-turn-helix transcriptional regulator | - |
| Q6379_RS08330 (Q6379_08330) | - | 1591205..1591432 (+) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| Q6379_RS08335 (Q6379_08335) | - | 1591429..1592439 (+) | 1011 | WP_304672914.1 | helix-turn-helix domain-containing protein | - |
| Q6379_RS08340 (Q6379_08340) | - | 1592453..1593235 (+) | 783 | WP_025456432.1 | ATP-binding protein | - |
| Q6379_RS08345 (Q6379_08345) | - | 1593248..1593511 (+) | 264 | WP_154235845.1 | hypothetical protein | - |
| Q6379_RS08350 (Q6379_08350) | - | 1593550..1594044 (+) | 495 | WP_041421248.1 | DUF3310 domain-containing protein | - |
| Q6379_RS08355 (Q6379_08355) | - | 1594221..1594370 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| Q6379_RS08360 (Q6379_08360) | - | 1594399..1594680 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| Q6379_RS08365 (Q6379_08365) | - | 1594671..1595051 (+) | 381 | WP_033910829.1 | RusA family crossover junction endodeoxyribonuclease | - |
| Q6379_RS08370 (Q6379_08370) | - | 1595380..1596342 (-) | 963 | WP_149032462.1 | IS110 family transposase | - |
| Q6379_RS08375 (Q6379_08375) | - | 1596871..1597230 (-) | 360 | WP_003691563.1 | hypothetical protein | - |
| Q6379_RS08380 (Q6379_08380) | - | 1597351..1598423 (-) | 1073 | Protein_1624 | zonular occludens toxin domain-containing protein | - |
| Q6379_RS08385 (Q6379_08385) | - | 1598433..1598723 (-) | 291 | WP_047917922.1 | DUF2523 domain-containing protein | - |
| Q6379_RS08390 (Q6379_08390) | - | 1598702..1600291 (-) | 1590 | WP_304672903.1 | IgG-binding virulence factor TspB family protein | - |
| Q6379_RS08395 (Q6379_08395) | - | 1600233..1600550 (-) | 318 | WP_003689167.1 | DUF1132 family protein | - |
| Q6379_RS08400 (Q6379_08400) | - | 1600678..1600956 (-) | 279 | WP_003691583.1 | hypothetical protein | - |
| Q6379_RS08405 (Q6379_08405) | - | 1600963..1601181 (-) | 219 | WP_003691584.1 | major capsid protein | - |
| Q6379_RS08410 (Q6379_08410) | - | 1601255..1601452 (-) | 198 | WP_003689600.1 | hypothetical protein | - |
| Q6379_RS08415 (Q6379_08415) | - | 1601457..1601747 (-) | 291 | WP_012503914.1 | hypothetical protein | - |
| Q6379_RS08420 (Q6379_08420) | - | 1601792..1603140 (-) | 1349 | Protein_1632 | replication initiation factor domain-containing protein | - |
| Q6379_RS08425 (Q6379_08425) | - | 1603279..1603701 (-) | 423 | WP_003691751.1 | very short patch repair endonuclease | - |
| Q6379_RS08430 (Q6379_08430) | - | 1603707..1604303 (-) | 597 | WP_012503916.1 | TIGR02391 family protein | - |
| Q6379_RS08435 (Q6379_08435) | - | 1604493..1605350 (-) | 858 | WP_012503917.1 | ATP-binding protein | - |
| Q6379_RS08440 (Q6379_08440) | - | 1605364..1605735 (-) | 372 | WP_012503918.1 | DNA cytosine methyltransferase | - |
| Q6379_RS08445 (Q6379_08445) | - | 1605732..1606340 (-) | 609 | WP_080229275.1 | DNA cytosine methyltransferase | - |
| Q6379_RS08450 (Q6379_08450) | - | 1606709..1606855 (+) | 147 | WP_003691757.1 | hypothetical protein | - |
| Q6379_RS08455 (Q6379_08455) | comP | 1607232..1607681 (-) | 450 | WP_002214937.1 | type IV pilin protein | Machinery gene |
| Q6379_RS08460 (Q6379_08460) | comE | 1607770..1608165 (-) | 396 | WP_003703428.1 | helix-hairpin-helix domain-containing protein | Machinery gene |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 13796.61 Da Isoelectric Point: 10.8790
>NTDB_id=861749 Q6379_RS08460 WP_003703428.1 1607770..1608165(-) (comE) [Neisseria gonorrhoeae strain NJ204705]
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK
MSRGGATPYRFLLIRHIVARCGLLFATLKGKTMKKMFVLFCMLFSCAFSLAAVNINAASQQELEALPGIGPAKAKAIAEY
RAQNGAFKSVDDLIKVKGIGPAVLAKLKDQASVGAPAPKGPAKPVLPAVKK
Nucleotide
Download Length: 396 bp
>NTDB_id=861749 Q6379_RS08460 WP_003703428.1 1607770..1608165(-) (comE) [Neisseria gonorrhoeae strain NJ204705]
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG
TTGAGCCGGGGCGGGGCAACGCCGTACCGGTTTTTGTTAATCCGCCATATCGTCGCAAGATGCGGTTTGTTGTTTGCAAC
CCTTAAAGGAAAAACCATGAAAAAAATGTTTGTATTGTTCTGTATGCTGTTCTCCTGCGCCTTCTCCCTTGCGGCGGTAA
ACATCAATGCGGCTTCGCAGCAGGAGCTGGAGGCGCTGCCGGGCATAGGCCCGGCGAAGGCGAAGGCCATTGCGGAATAC
CGCGCGCAAAACGGCGCGTTCAAGTCTGTGGACGATTTGATCAAGGTGAAGGGCATCGGTCCGGCGGTGCTGGCGAAGCT
GAAAGACCAGGCTTCCGTCGGCGCGCCCGCACCAAAAGGCCCCGCCAAACCGGTGCTGCCTGCGGTTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comE | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |