Detailed information    

insolico Bioinformatically predicted

Overview


Name   comP   Type   Machinery gene
Locus tag   Q6379_RS08455 Genome accession   NZ_CP130892
Coordinates   1607232..1607681 (-) Length   149 a.a.
NCBI ID   WP_002214937.1    Uniprot ID   A0AA44U8B7
Organism   Neisseria gonorrhoeae strain NJ204705     
Function   DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1575922..1606983 1607232..1607681 flank 249


Gene organization within MGE regions


Location: 1575922..1607681
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q6379_RS08205 (Q6379_08205) - 1575950..1576924 (-) 975 WP_003689550.1 SIS domain-containing protein -
  Q6379_RS08210 (Q6379_08210) tal 1577021..1578076 (+) 1056 WP_003689551.1 transaldolase -
  Q6379_RS08215 (Q6379_08215) - 1578088..1578222 (+) 135 WP_012503902.1 hypothetical protein -
  Q6379_RS08220 (Q6379_08220) - 1578227..1578517 (+) 291 WP_003689553.1 hypothetical protein -
  Q6379_RS08225 (Q6379_08225) gluQRS 1578534..1579421 (+) 888 WP_003689554.1 tRNA glutamyl-Q(34) synthetase GluQRS -
  Q6379_RS08230 (Q6379_08230) dusA 1579491..1580507 (-) 1017 WP_003689555.1 tRNA dihydrouridine(20/20a) synthase DusA -
  Q6379_RS08235 (Q6379_08235) - 1580627..1581781 (+) 1155 WP_003697468.1 tyrosine-type recombinase/integrase -
  Q6379_RS08240 (Q6379_08240) - 1581831..1582097 (-) 267 WP_003689557.1 pyocin activator PrtN family protein -
  Q6379_RS08245 (Q6379_08245) - 1582205..1583152 (-) 948 WP_012503904.1 hypothetical protein -
  Q6379_RS08250 (Q6379_08250) - 1583124..1583354 (-) 231 WP_003695893.1 hypothetical protein -
  Q6379_RS08255 (Q6379_08255) - 1583351..1584334 (-) 984 WP_047952517.1 hypothetical protein -
  Q6379_RS08260 (Q6379_08260) - 1584445..1584660 (-) 216 WP_003691538.1 hypothetical protein -
  Q6379_RS08265 (Q6379_08265) - 1584712..1585203 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  Q6379_RS08270 (Q6379_08270) - 1585200..1585382 (-) 183 WP_003691535.1 hypothetical protein -
  Q6379_RS08275 (Q6379_08275) - 1585522..1586208 (-) 687 WP_042758540.1 phage replication initiation protein, NGO0469 family -
  Q6379_RS08280 (Q6379_08280) - 1586277..1586438 (-) 162 WP_003691530.1 hypothetical protein -
  Q6379_RS08285 (Q6379_08285) - 1586435..1586710 (-) 276 WP_003703838.1 NGO1622 family putative holin -
  Q6379_RS08290 (Q6379_08290) - 1586864..1587196 (-) 333 WP_003696914.1 hypothetical protein -
  Q6379_RS08295 (Q6379_08295) - 1587337..1587624 (-) 288 WP_304672913.1 hypothetical protein -
  Q6379_RS08300 (Q6379_08300) - 1587621..1588097 (-) 477 WP_002255718.1 hypothetical protein -
  Q6379_RS08305 (Q6379_08305) - 1588130..1588330 (-) 201 WP_047954343.1 hypothetical protein -
  Q6379_RS08310 (Q6379_08310) - 1588814..1589032 (+) 219 WP_003691731.1 hypothetical protein -
  Q6379_RS08315 (Q6379_08315) - 1589049..1589408 (-) 360 WP_003691733.1 hypothetical protein -
  Q6379_RS08320 (Q6379_08320) - 1589409..1589948 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  Q6379_RS08325 (Q6379_08325) - 1590108..1590824 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  Q6379_RS08330 (Q6379_08330) - 1591205..1591432 (+) 228 WP_003691442.1 helix-turn-helix domain-containing protein -
  Q6379_RS08335 (Q6379_08335) - 1591429..1592439 (+) 1011 WP_304672914.1 helix-turn-helix domain-containing protein -
  Q6379_RS08340 (Q6379_08340) - 1592453..1593235 (+) 783 WP_025456432.1 ATP-binding protein -
  Q6379_RS08345 (Q6379_08345) - 1593248..1593511 (+) 264 WP_154235845.1 hypothetical protein -
  Q6379_RS08350 (Q6379_08350) - 1593550..1594044 (+) 495 WP_041421248.1 DUF3310 domain-containing protein -
  Q6379_RS08355 (Q6379_08355) - 1594221..1594370 (+) 150 WP_003689110.1 hypothetical protein -
  Q6379_RS08360 (Q6379_08360) - 1594399..1594680 (+) 282 WP_003689109.1 hypothetical protein -
  Q6379_RS08365 (Q6379_08365) - 1594671..1595051 (+) 381 WP_033910829.1 RusA family crossover junction endodeoxyribonuclease -
  Q6379_RS08370 (Q6379_08370) - 1595380..1596342 (-) 963 WP_149032462.1 IS110 family transposase -
  Q6379_RS08375 (Q6379_08375) - 1596871..1597230 (-) 360 WP_003691563.1 hypothetical protein -
  Q6379_RS08380 (Q6379_08380) - 1597351..1598423 (-) 1073 Protein_1624 zonular occludens toxin domain-containing protein -
  Q6379_RS08385 (Q6379_08385) - 1598433..1598723 (-) 291 WP_047917922.1 DUF2523 domain-containing protein -
  Q6379_RS08390 (Q6379_08390) - 1598702..1600291 (-) 1590 WP_304672903.1 IgG-binding virulence factor TspB family protein -
  Q6379_RS08395 (Q6379_08395) - 1600233..1600550 (-) 318 WP_003689167.1 DUF1132 family protein -
  Q6379_RS08400 (Q6379_08400) - 1600678..1600956 (-) 279 WP_003691583.1 hypothetical protein -
  Q6379_RS08405 (Q6379_08405) - 1600963..1601181 (-) 219 WP_003691584.1 major capsid protein -
  Q6379_RS08410 (Q6379_08410) - 1601255..1601452 (-) 198 WP_003689600.1 hypothetical protein -
  Q6379_RS08415 (Q6379_08415) - 1601457..1601747 (-) 291 WP_012503914.1 hypothetical protein -
  Q6379_RS08420 (Q6379_08420) - 1601792..1603140 (-) 1349 Protein_1632 replication initiation factor domain-containing protein -
  Q6379_RS08425 (Q6379_08425) - 1603279..1603701 (-) 423 WP_003691751.1 very short patch repair endonuclease -
  Q6379_RS08430 (Q6379_08430) - 1603707..1604303 (-) 597 WP_012503916.1 TIGR02391 family protein -
  Q6379_RS08435 (Q6379_08435) - 1604493..1605350 (-) 858 WP_012503917.1 ATP-binding protein -
  Q6379_RS08440 (Q6379_08440) - 1605364..1605735 (-) 372 WP_012503918.1 DNA cytosine methyltransferase -
  Q6379_RS08445 (Q6379_08445) - 1605732..1606340 (-) 609 WP_080229275.1 DNA cytosine methyltransferase -
  Q6379_RS08450 (Q6379_08450) - 1606709..1606855 (+) 147 WP_003691757.1 hypothetical protein -
  Q6379_RS08455 (Q6379_08455) comP 1607232..1607681 (-) 450 WP_002214937.1 type IV pilin protein Machinery gene

Sequence


Protein


Download         Length: 149 a.a.        Molecular weight: 16834.81 Da        Isoelectric Point: 9.7951

>NTDB_id=861748 Q6379_RS08455 WP_002214937.1 1607232..1607681(-) (comP) [Neisseria gonorrhoeae strain NJ204705]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK

Nucleotide


Download         Length: 450 bp        

>NTDB_id=861748 Q6379_RS08455 WP_002214937.1 1607232..1607681(-) (comP) [Neisseria gonorrhoeae strain NJ204705]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comP Neisseria gonorrhoeae MS11

100

100

1

  comP Neisseria meningitidis 8013

99.329

100

0.993

  comP Neisseria subflava NJ9703

49.66

98.658

0.49