Detailed information
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | Q6379_RS02675 | Genome accession | NZ_CP130892 |
| Coordinates | 519812..520285 (+) | Length | 157 a.a. |
| NCBI ID | WP_304672966.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain NJ204705 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 515272..558978 | 519812..520285 | within | 0 |
Gene organization within MGE regions
Location: 515272..558978
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Q6379_RS02650 (Q6379_02650) | dnaB | 515272..516678 (+) | 1407 | WP_003690896.1 | replicative DNA helicase | - |
| Q6379_RS02655 (Q6379_02655) | pilH | 516986..517651 (+) | 666 | WP_047921008.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| Q6379_RS02660 (Q6379_02660) | pilI | 517683..518291 (+) | 609 | WP_304672949.1 | type IV pilus modification protein PilV | Machinery gene |
| Q6379_RS02665 (Q6379_02665) | pilJ | 518288..519223 (+) | 936 | WP_047921001.1 | PilW family protein | Machinery gene |
| Q6379_RS02670 (Q6379_02670) | pilK | 519202..519810 (+) | 609 | WP_047921003.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| Q6379_RS02675 (Q6379_02675) | pilL | 519812..520285 (+) | 474 | WP_304672966.1 | PilX family type IV pilin | Machinery gene |
| Q6379_RS02680 (Q6379_02680) | - | 520355..520663 (-) | 309 | WP_003706588.1 | AzlD family protein | - |
| Q6379_RS02685 (Q6379_02685) | - | 520660..521371 (-) | 712 | Protein_521 | AzlC family ABC transporter permease | - |
| Q6379_RS02690 (Q6379_02690) | dut | 521537..521989 (+) | 453 | WP_003701071.1 | dUTP diphosphatase | - |
| Q6379_RS02695 (Q6379_02695) | dapC | 522061..523248 (+) | 1188 | WP_003701073.1 | succinyldiaminopimelate transaminase | - |
| Q6379_RS02700 (Q6379_02700) | yaaA | 523404..524183 (+) | 780 | WP_003687925.1 | peroxide stress protein YaaA | - |
| Q6379_RS02715 (Q6379_02715) | - | 524713..525913 (+) | 1201 | Protein_525 | tyrosine-type recombinase/integrase | - |
| Q6379_RS02720 (Q6379_02720) | - | 526269..526538 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| Q6379_RS02725 (Q6379_02725) | - | 526733..527416 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| Q6379_RS11955 | - | 527730..527963 (-) | 234 | Protein_528 | hypothetical protein | - |
| Q6379_RS02735 (Q6379_02735) | - | 528074..528289 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| Q6379_RS02740 (Q6379_02740) | - | 528341..528832 (-) | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| Q6379_RS02745 (Q6379_02745) | - | 528829..529011 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| Q6379_RS02750 (Q6379_02750) | - | 529151..529837 (-) | 687 | WP_042758540.1 | phage replication initiation protein, NGO0469 family | - |
| Q6379_RS02755 (Q6379_02755) | - | 529906..530067 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| Q6379_RS02760 (Q6379_02760) | - | 530064..530342 (-) | 279 | WP_003691529.1 | NGO1622 family putative holin | - |
| Q6379_RS02765 (Q6379_02765) | - | 530495..530827 (-) | 333 | WP_003695500.1 | hypothetical protein | - |
| Q6379_RS02770 (Q6379_02770) | - | 530968..531255 (-) | 288 | WP_304672901.1 | hypothetical protein | - |
| Q6379_RS02775 (Q6379_02775) | - | 531252..531728 (-) | 477 | WP_002255718.1 | hypothetical protein | - |
| Q6379_RS02780 (Q6379_02780) | - | 531761..531961 (-) | 201 | WP_047954343.1 | hypothetical protein | - |
| Q6379_RS02785 (Q6379_02785) | - | 532159..532572 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| Q6379_RS02790 (Q6379_02790) | - | 532569..533030 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| Q6379_RS02795 (Q6379_02795) | - | 533047..533484 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| Q6379_RS02800 (Q6379_02800) | - | 533599..534315 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| Q6379_RS02805 (Q6379_02805) | - | 534384..534620 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| Q6379_RS02810 (Q6379_02810) | - | 534700..534855 (+) | 156 | WP_003691446.1 | hypothetical protein | - |
| Q6379_RS02815 (Q6379_02815) | - | 534832..535020 (-) | 189 | WP_003706568.1 | hypothetical protein | - |
| Q6379_RS02820 (Q6379_02820) | - | 535193..535420 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| Q6379_RS02825 (Q6379_02825) | - | 535417..535554 (+) | 138 | WP_010359998.1 | hypothetical protein | - |
| Q6379_RS02830 (Q6379_02830) | - | 536099..536602 (+) | 504 | WP_010360005.1 | hypothetical protein | - |
| Q6379_RS02835 (Q6379_02835) | - | 536599..537960 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| Q6379_RS02840 (Q6379_02840) | - | 537997..538260 (+) | 264 | WP_154235845.1 | hypothetical protein | - |
| Q6379_RS02845 (Q6379_02845) | - | 538299..538793 (+) | 495 | WP_041421248.1 | DUF3310 domain-containing protein | - |
| Q6379_RS02850 (Q6379_02850) | - | 538970..539119 (+) | 150 | WP_003692854.1 | hypothetical protein | - |
| Q6379_RS02855 (Q6379_02855) | - | 539148..539429 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| Q6379_RS02860 (Q6379_02860) | - | 539420..539857 (+) | 438 | WP_106278737.1 | RusA family crossover junction endodeoxyribonuclease | - |
| Q6379_RS02865 (Q6379_02865) | - | 539850..540155 (+) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| Q6379_RS02870 (Q6379_02870) | - | 540152..540535 (+) | 384 | WP_003690918.1 | recombination protein NinB | - |
| Q6379_RS02875 (Q6379_02875) | - | 540526..541044 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| Q6379_RS02880 (Q6379_02880) | - | 541109..541531 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| Q6379_RS02885 (Q6379_02885) | - | 541531..542070 (+) | 540 | WP_003690920.1 | hypothetical protein | - |
| Q6379_RS02890 (Q6379_02890) | - | 542051..543325 (+) | 1275 | WP_003701186.1 | PBSX family phage terminase large subunit | - |
| Q6379_RS02895 (Q6379_02895) | - | 543310..545577 (+) | 2268 | WP_225577510.1 | hypothetical protein | - |
| Q6379_RS02900 (Q6379_02900) | - | 545814..547010 (+) | 1197 | WP_003687992.1 | hypothetical protein | - |
| Q6379_RS02905 (Q6379_02905) | - | 547007..548221 (+) | 1215 | WP_044270986.1 | hypothetical protein | - |
| Q6379_RS02910 (Q6379_02910) | - | 551115..554219 (+) | 3105 | Protein_564 | PLxRFG domain-containing protein | - |
| Q6379_RS02915 (Q6379_02915) | - | 554201..554938 (+) | 738 | WP_003690932.1 | hypothetical protein | - |
| Q6379_RS02920 (Q6379_02920) | - | 554959..556254 (+) | 1296 | WP_033910739.1 | DUF4043 family protein | - |
| Q6379_RS02925 (Q6379_02925) | - | 556309..556782 (+) | 474 | WP_003690936.1 | hypothetical protein | - |
| Q6379_RS02930 (Q6379_02930) | - | 556788..557273 (+) | 486 | WP_003687997.1 | hypothetical protein | - |
| Q6379_RS02935 (Q6379_02935) | - | 557270..557944 (+) | 675 | WP_003687998.1 | hypothetical protein | - |
| Q6379_RS02940 (Q6379_02940) | - | 557947..558096 (+) | 150 | WP_003706419.1 | hypothetical protein | - |
| Q6379_RS02945 (Q6379_02945) | - | 558133..558978 (-) | 846 | WP_012503500.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17560.33 Da Isoelectric Point: 9.5776
>NTDB_id=861734 Q6379_RS02675 WP_304672966.1 519812..520285(+) (pilL) [Neisseria gonorrhoeae strain NJ204705]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDILKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDILKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRVYRLVGVPNAGTGYTLSVWMNSVGDGYKCRNATSAQTYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=861734 Q6379_RS02675 WP_304672966.1 519812..520285(+) (pilL) [Neisseria gonorrhoeae strain NJ204705]
ATGGAGCAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACAATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATATCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGTGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAGCAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACAATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATATCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGTATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGTGACGGATACAAATGCCGTAATGCCA
CTTCTGCCCAGACCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
96.178 |
100 |
0.962 |
| pilX | Neisseria meningitidis 8013 |
83.439 |
100 |
0.834 |