Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilI   Type   Machinery gene
Locus tag   Q6379_RS02660 Genome accession   NZ_CP130892
Coordinates   517683..518291 (+) Length   202 a.a.
NCBI ID   WP_304672949.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain NJ204705     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 515272..558978 517683..518291 within 0


Gene organization within MGE regions


Location: 515272..558978
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q6379_RS02650 (Q6379_02650) dnaB 515272..516678 (+) 1407 WP_003690896.1 replicative DNA helicase -
  Q6379_RS02655 (Q6379_02655) pilH 516986..517651 (+) 666 WP_047921008.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  Q6379_RS02660 (Q6379_02660) pilI 517683..518291 (+) 609 WP_304672949.1 type IV pilus modification protein PilV Machinery gene
  Q6379_RS02665 (Q6379_02665) pilJ 518288..519223 (+) 936 WP_047921001.1 PilW family protein Machinery gene
  Q6379_RS02670 (Q6379_02670) pilK 519202..519810 (+) 609 WP_047921003.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  Q6379_RS02675 (Q6379_02675) pilL 519812..520285 (+) 474 WP_304672966.1 PilX family type IV pilin Machinery gene
  Q6379_RS02680 (Q6379_02680) - 520355..520663 (-) 309 WP_003706588.1 AzlD family protein -
  Q6379_RS02685 (Q6379_02685) - 520660..521371 (-) 712 Protein_521 AzlC family ABC transporter permease -
  Q6379_RS02690 (Q6379_02690) dut 521537..521989 (+) 453 WP_003701071.1 dUTP diphosphatase -
  Q6379_RS02695 (Q6379_02695) dapC 522061..523248 (+) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  Q6379_RS02700 (Q6379_02700) yaaA 523404..524183 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  Q6379_RS02715 (Q6379_02715) - 524713..525913 (+) 1201 Protein_525 tyrosine-type recombinase/integrase -
  Q6379_RS02720 (Q6379_02720) - 526269..526538 (-) 270 WP_003687928.1 hypothetical protein -
  Q6379_RS02725 (Q6379_02725) - 526733..527416 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  Q6379_RS11955 - 527730..527963 (-) 234 Protein_528 hypothetical protein -
  Q6379_RS02735 (Q6379_02735) - 528074..528289 (-) 216 WP_003691538.1 hypothetical protein -
  Q6379_RS02740 (Q6379_02740) - 528341..528832 (-) 492 WP_003691537.1 siphovirus Gp157 family protein -
  Q6379_RS02745 (Q6379_02745) - 528829..529011 (-) 183 WP_003691535.1 hypothetical protein -
  Q6379_RS02750 (Q6379_02750) - 529151..529837 (-) 687 WP_042758540.1 phage replication initiation protein, NGO0469 family -
  Q6379_RS02755 (Q6379_02755) - 529906..530067 (-) 162 WP_003691530.1 hypothetical protein -
  Q6379_RS02760 (Q6379_02760) - 530064..530342 (-) 279 WP_003691529.1 NGO1622 family putative holin -
  Q6379_RS02765 (Q6379_02765) - 530495..530827 (-) 333 WP_003695500.1 hypothetical protein -
  Q6379_RS02770 (Q6379_02770) - 530968..531255 (-) 288 WP_304672901.1 hypothetical protein -
  Q6379_RS02775 (Q6379_02775) - 531252..531728 (-) 477 WP_002255718.1 hypothetical protein -
  Q6379_RS02780 (Q6379_02780) - 531761..531961 (-) 201 WP_047954343.1 hypothetical protein -
  Q6379_RS02785 (Q6379_02785) - 532159..532572 (-) 414 WP_003687963.1 hypothetical protein -
  Q6379_RS02790 (Q6379_02790) - 532569..533030 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  Q6379_RS02795 (Q6379_02795) - 533047..533484 (-) 438 WP_003687967.1 hypothetical protein -
  Q6379_RS02800 (Q6379_02800) - 533599..534315 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  Q6379_RS02805 (Q6379_02805) - 534384..534620 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  Q6379_RS02810 (Q6379_02810) - 534700..534855 (+) 156 WP_003691446.1 hypothetical protein -
  Q6379_RS02815 (Q6379_02815) - 534832..535020 (-) 189 WP_003706568.1 hypothetical protein -
  Q6379_RS02820 (Q6379_02820) - 535193..535420 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  Q6379_RS02825 (Q6379_02825) - 535417..535554 (+) 138 WP_010359998.1 hypothetical protein -
  Q6379_RS02830 (Q6379_02830) - 536099..536602 (+) 504 WP_010360005.1 hypothetical protein -
  Q6379_RS02835 (Q6379_02835) - 536599..537960 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  Q6379_RS02840 (Q6379_02840) - 537997..538260 (+) 264 WP_154235845.1 hypothetical protein -
  Q6379_RS02845 (Q6379_02845) - 538299..538793 (+) 495 WP_041421248.1 DUF3310 domain-containing protein -
  Q6379_RS02850 (Q6379_02850) - 538970..539119 (+) 150 WP_003692854.1 hypothetical protein -
  Q6379_RS02855 (Q6379_02855) - 539148..539429 (+) 282 WP_003689109.1 hypothetical protein -
  Q6379_RS02860 (Q6379_02860) - 539420..539857 (+) 438 WP_106278737.1 RusA family crossover junction endodeoxyribonuclease -
  Q6379_RS02865 (Q6379_02865) - 539850..540155 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  Q6379_RS02870 (Q6379_02870) - 540152..540535 (+) 384 WP_003690918.1 recombination protein NinB -
  Q6379_RS02875 (Q6379_02875) - 540526..541044 (+) 519 WP_003687984.1 HNH endonuclease -
  Q6379_RS02880 (Q6379_02880) - 541109..541531 (+) 423 WP_003690919.1 hypothetical protein -
  Q6379_RS02885 (Q6379_02885) - 541531..542070 (+) 540 WP_003690920.1 hypothetical protein -
  Q6379_RS02890 (Q6379_02890) - 542051..543325 (+) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  Q6379_RS02895 (Q6379_02895) - 543310..545577 (+) 2268 WP_225577510.1 hypothetical protein -
  Q6379_RS02900 (Q6379_02900) - 545814..547010 (+) 1197 WP_003687992.1 hypothetical protein -
  Q6379_RS02905 (Q6379_02905) - 547007..548221 (+) 1215 WP_044270986.1 hypothetical protein -
  Q6379_RS02910 (Q6379_02910) - 551115..554219 (+) 3105 Protein_564 PLxRFG domain-containing protein -
  Q6379_RS02915 (Q6379_02915) - 554201..554938 (+) 738 WP_003690932.1 hypothetical protein -
  Q6379_RS02920 (Q6379_02920) - 554959..556254 (+) 1296 WP_033910739.1 DUF4043 family protein -
  Q6379_RS02925 (Q6379_02925) - 556309..556782 (+) 474 WP_003690936.1 hypothetical protein -
  Q6379_RS02930 (Q6379_02930) - 556788..557273 (+) 486 WP_003687997.1 hypothetical protein -
  Q6379_RS02935 (Q6379_02935) - 557270..557944 (+) 675 WP_003687998.1 hypothetical protein -
  Q6379_RS02940 (Q6379_02940) - 557947..558096 (+) 150 WP_003706419.1 hypothetical protein -
  Q6379_RS02945 (Q6379_02945) - 558133..558978 (-) 846 WP_012503500.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 202 a.a.        Molecular weight: 22189.17 Da        Isoelectric Point: 4.9915

>NTDB_id=861731 Q6379_RS02660 WP_304672949.1 517683..518291(+) (pilI) [Neisseria gonorrhoeae strain NJ204705]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDSDSNKKN
YNLYTKSYPSTSSNGDFKLDNLISKRDLAKTQLDRFGYELKNALPDAVAIHYTVCKDLSGDAPTLSGNTFFPNCDNKANG
DTLIKVLWVNDSAGDSDISRTNLEVSGDNIVYTYQARVGGRE

Nucleotide


Download         Length: 609 bp        

>NTDB_id=861731 Q6379_RS02660 WP_304672949.1 517683..518291(+) (pilI) [Neisseria gonorrhoeae strain NJ204705]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGTTGATAGAAGTCTTGGTCGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGTTGTCCGTACAGTTGCGGACAGTCGCTTCCGTCAGGGAGGCGGAGACACAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTCGGACAGCAACAAGAAAAAC
TATAATCTTTACACGAAGTCGTACCCCTCCACTTCCTCTAACGGCGATTTCAAGCTTGATAATTTGATAAGTAAGAGGGA
TTTGGCAAAGACCCAGTTGGACAGGTTCGGTTATGAATTGAAAAATGCCTTGCCGGATGCGGTAGCTATTCATTACACCG
TCTGCAAGGATTTGTCGGGTGACGCGCCGACATTGTCCGGCAATACTTTTTTTCCAAATTGCGACAATAAGGCAAACGGG
GATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGAGGTGAGCGG
CGACAATATCGTATATACCTATCAGGCAAGGGTCGGAGGTCGTGAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilI Neisseria gonorrhoeae MS11

91.584

100

0.916

  pilV Neisseria gonorrhoeae MS11

91.584

100

0.916

  pilV Neisseria meningitidis 8013

84.951

100

0.866