Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   QAP04_RS06950 Genome accession   NZ_CP130623
Coordinates   1457758..1457871 (-) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori strain BS04     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1452758..1462871
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QAP04_RS06930 (QAP04_06900) - 1453435..1454847 (-) 1413 WP_373961250.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  QAP04_RS06935 (QAP04_06905) comB10 1454918..1456048 (-) 1131 WP_373961251.1 DNA type IV secretion system protein ComB10 Machinery gene
  QAP04_RS06940 (QAP04_06910) comB9 1456041..1457018 (-) 978 WP_373961252.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  QAP04_RS06945 (QAP04_06915) comB8 1457018..1457761 (-) 744 WP_033735961.1 virB8 family protein Machinery gene
  QAP04_RS06950 (QAP04_06920) comB7 1457758..1457871 (-) 114 WP_001217873.1 hypothetical protein Machinery gene
  QAP04_RS06955 (QAP04_06925) comB6 1457887..1458942 (-) 1056 WP_373961815.1 type IV secretion system protein Machinery gene
  QAP04_RS06960 (QAP04_06930) - 1458950..1459945 (-) 996 WP_373961253.1 PDZ domain-containing protein -
  QAP04_RS06965 (QAP04_06935) - 1459945..1460238 (-) 294 WP_000347921.1 YbaB/EbfC family nucleoid-associated protein -
  QAP04_RS06970 (QAP04_06940) panD 1460241..1460594 (-) 354 WP_373961254.1 aspartate 1-decarboxylase -
  QAP04_RS06975 (QAP04_06945) - 1460584..1462809 (-) 2226 WP_373961255.1 AAA family ATPase -

Sequence

Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=860747 QAP04_RS06950 WP_001217873.1 1457758..1457871(-) (comB7) [Helicobacter pylori strain BS04]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=860747 QAP04_RS06950 WP_001217873.1 1457758..1457871(-) (comB7) [Helicobacter pylori strain BS04]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1