Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   Q3Y59_RS11945 Genome accession   NZ_CP130608
Coordinates   2472051..2472488 (-) Length   145 a.a.
NCBI ID   WP_043867285.1    Uniprot ID   -
Organism   Bacillus velezensis strain XDY66     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2467051..2477488
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q3Y59_RS11895 (Q3Y59_11895) sinI 2467436..2467609 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  Q3Y59_RS11900 (Q3Y59_11900) sinR 2467643..2467978 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  Q3Y59_RS11905 (Q3Y59_11905) tasA 2468026..2468811 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  Q3Y59_RS11910 (Q3Y59_11910) sipW 2468875..2469459 (-) 585 WP_003153100.1 signal peptidase I SipW -
  Q3Y59_RS11915 (Q3Y59_11915) tapA 2469431..2470102 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  Q3Y59_RS11920 (Q3Y59_11920) - 2470361..2470690 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  Q3Y59_RS11925 (Q3Y59_11925) - 2470730..2470909 (-) 180 WP_003153093.1 YqzE family protein -
  Q3Y59_RS11930 (Q3Y59_11930) comGG 2470966..2471343 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  Q3Y59_RS11935 (Q3Y59_11935) comGF 2471344..2471739 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  Q3Y59_RS11940 (Q3Y59_11940) comGE 2471753..2472067 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  Q3Y59_RS11945 (Q3Y59_11945) comGD 2472051..2472488 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  Q3Y59_RS11950 (Q3Y59_11950) comGC 2472478..2472786 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  Q3Y59_RS11955 (Q3Y59_11955) comGB 2472791..2473828 (-) 1038 WP_024085602.1 competence type IV pilus assembly protein ComGB Machinery gene
  Q3Y59_RS11960 (Q3Y59_11960) comGA 2473815..2474885 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  Q3Y59_RS11965 (Q3Y59_11965) - 2475077..2476027 (-) 951 WP_003153082.1 magnesium transporter CorA family protein -
  Q3Y59_RS11970 (Q3Y59_11970) - 2476173..2477474 (+) 1302 WP_014305416.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16268.79 Da        Isoelectric Point: 10.3354

>NTDB_id=860596 Q3Y59_RS11945 WP_043867285.1 2472051..2472488(-) (comGD) [Bacillus velezensis strain XDY66]
MNNNRRTENGFTLLESLVVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=860596 Q3Y59_RS11945 WP_043867285.1 2472051..2472488(-) (comGD) [Bacillus velezensis strain XDY66]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGGTTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTTGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566