Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   Q3Y59_RS11895 Genome accession   NZ_CP130608
Coordinates   2467436..2467609 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain XDY66     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2462436..2472609
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q3Y59_RS11880 (Q3Y59_11880) gcvT 2463253..2464353 (-) 1101 WP_303302216.1 glycine cleavage system aminomethyltransferase GcvT -
  Q3Y59_RS11885 (Q3Y59_11885) - 2464777..2466447 (+) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  Q3Y59_RS11890 (Q3Y59_11890) - 2466465..2467259 (+) 795 WP_003153106.1 YqhG family protein -
  Q3Y59_RS11895 (Q3Y59_11895) sinI 2467436..2467609 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  Q3Y59_RS11900 (Q3Y59_11900) sinR 2467643..2467978 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  Q3Y59_RS11905 (Q3Y59_11905) tasA 2468026..2468811 (-) 786 WP_003153102.1 biofilm matrix protein TasA -
  Q3Y59_RS11910 (Q3Y59_11910) sipW 2468875..2469459 (-) 585 WP_003153100.1 signal peptidase I SipW -
  Q3Y59_RS11915 (Q3Y59_11915) tapA 2469431..2470102 (-) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  Q3Y59_RS11920 (Q3Y59_11920) - 2470361..2470690 (+) 330 WP_003153097.1 DUF3889 domain-containing protein -
  Q3Y59_RS11925 (Q3Y59_11925) - 2470730..2470909 (-) 180 WP_003153093.1 YqzE family protein -
  Q3Y59_RS11930 (Q3Y59_11930) comGG 2470966..2471343 (-) 378 WP_003153092.1 competence type IV pilus minor pilin ComGG Machinery gene
  Q3Y59_RS11935 (Q3Y59_11935) comGF 2471344..2471739 (-) 396 WP_003153090.1 competence type IV pilus minor pilin ComGF -
  Q3Y59_RS11940 (Q3Y59_11940) comGE 2471753..2472067 (-) 315 WP_003153089.1 competence type IV pilus minor pilin ComGE -
  Q3Y59_RS11945 (Q3Y59_11945) comGD 2472051..2472488 (-) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=860593 Q3Y59_RS11895 WP_003153105.1 2467436..2467609(+) (sinI) [Bacillus velezensis strain XDY66]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=860593 Q3Y59_RS11895 WP_003153105.1 2467436..2467609(+) (sinI) [Bacillus velezensis strain XDY66]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702