Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   Q4I20_RS17225 Genome accession   NZ_CP130597
Coordinates   3255892..3256059 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain NCIB_3610     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3250892..3261059
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q4I20_RS17195 (Q4I20_17180) mrpE 3251287..3251763 (+) 477 WP_003244015.1 Na+/H+ antiporter subunit E -
  Q4I20_RS17200 (Q4I20_17185) mrpF 3251763..3252047 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  Q4I20_RS17205 (Q4I20_17190) mnhG 3252031..3252405 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  Q4I20_RS17210 (Q4I20_17195) yuxO 3252444..3252824 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  Q4I20_RS17215 (Q4I20_17200) comA 3252843..3253487 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  Q4I20_RS17220 (Q4I20_17205) comP 3253568..3255877 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  Q4I20_RS17225 (Q4I20_17210) comX 3255892..3256059 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  Q4I20_RS17230 (Q4I20_17215) comQ 3256047..3256946 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  Q4I20_RS17235 (Q4I20_17220) degQ 3257131..3257271 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  Q4I20_RS17240 (Q4I20_17225) - 3257493..3257618 (+) 126 WP_003228793.1 hypothetical protein -
  Q4I20_RS17245 (Q4I20_17230) - 3257732..3258100 (+) 369 WP_003243784.1 hypothetical protein -
  Q4I20_RS17250 (Q4I20_17235) pdeH 3258076..3259305 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  Q4I20_RS17255 (Q4I20_17240) pncB 3259442..3260914 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=860480 Q4I20_RS17225 WP_003242801.1 3255892..3256059(-) (comX) [Bacillus subtilis strain NCIB_3610]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=860480 Q4I20_RS17225 WP_003242801.1 3255892..3256059(-) (comX) [Bacillus subtilis strain NCIB_3610]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1