Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   Q4I20_RS17235 Genome accession   NZ_CP130597
Coordinates   3257131..3257271 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain NCIB_3610     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3252131..3262271
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q4I20_RS17210 (Q4I20_17195) yuxO 3252444..3252824 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  Q4I20_RS17215 (Q4I20_17200) comA 3252843..3253487 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  Q4I20_RS17220 (Q4I20_17205) comP 3253568..3255877 (-) 2310 WP_003242894.1 two-component system sensor histidine kinase ComP Regulator
  Q4I20_RS17225 (Q4I20_17210) comX 3255892..3256059 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  Q4I20_RS17230 (Q4I20_17215) comQ 3256047..3256946 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  Q4I20_RS17235 (Q4I20_17220) degQ 3257131..3257271 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  Q4I20_RS17240 (Q4I20_17225) - 3257493..3257618 (+) 126 WP_003228793.1 hypothetical protein -
  Q4I20_RS17245 (Q4I20_17230) - 3257732..3258100 (+) 369 WP_003243784.1 hypothetical protein -
  Q4I20_RS17250 (Q4I20_17235) pdeH 3258076..3259305 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  Q4I20_RS17255 (Q4I20_17240) pncB 3259442..3260914 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  Q4I20_RS17260 (Q4I20_17245) pncA 3260930..3261481 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  Q4I20_RS17265 (Q4I20_17250) yueI 3261578..3261976 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=860482 Q4I20_RS17235 WP_003220708.1 3257131..3257271(-) (degQ) [Bacillus subtilis strain NCIB_3610]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=860482 Q4I20_RS17235 WP_003220708.1 3257131..3257271(-) (degQ) [Bacillus subtilis strain NCIB_3610]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1