Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   Q2B68_RS16235 Genome accession   NZ_CP130280
Coordinates   3257359..3257499 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus amyloliquefaciens strain PM415     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3252359..3262499
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  Q2B68_RS16210 (Q2B68_16210) - 3252699..3253082 (-) 384 WP_003152054.1 hotdog fold thioesterase -
  Q2B68_RS16215 (Q2B68_16215) comA 3253104..3253748 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  Q2B68_RS16220 (Q2B68_16220) comP 3253829..3256120 (-) 2292 WP_274413647.1 histidine kinase Regulator
  Q2B68_RS16225 (Q2B68_16225) comX 3256132..3256296 (-) 165 WP_007613432.1 competence pheromone ComX -
  Q2B68_RS16230 (Q2B68_16230) - 3256296..3257174 (-) 879 WP_231040471.1 polyprenyl synthetase family protein -
  Q2B68_RS16235 (Q2B68_16235) degQ 3257359..3257499 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  Q2B68_RS16240 (Q2B68_16240) - 3257965..3258306 (+) 342 WP_014305721.1 hypothetical protein -
  Q2B68_RS16245 (Q2B68_16245) - 3258313..3259533 (-) 1221 WP_003152038.1 EAL and HDOD domain-containing protein -
  Q2B68_RS16250 (Q2B68_16250) - 3259663..3261129 (-) 1467 WP_014305722.1 nicotinate phosphoribosyltransferase -
  Q2B68_RS16255 (Q2B68_16255) - 3261147..3261698 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  Q2B68_RS16260 (Q2B68_16260) - 3261795..3262193 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=857575 Q2B68_RS16235 WP_003152043.1 3257359..3257499(-) (degQ) [Bacillus amyloliquefaciens strain PM415]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=857575 Q2B68_RS16235 WP_003152043.1 3257359..3257499(-) (degQ) [Bacillus amyloliquefaciens strain PM415]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891