Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGG   Type   Machinery gene
Locus tag   BVAD3_RS12080 Genome accession   NZ_AP024501
Coordinates   2526402..2526779 (-) Length   125 a.a.
NCBI ID   WP_017418138.1    Uniprot ID   -
Organism   Bacillus velezensis strain AD-3     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2521402..2531779
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVAD3_RS12040 (BVAD3_23940) - 2521899..2522693 (+) 795 WP_014418368.1 YqhG family protein -
  BVAD3_RS12045 (BVAD3_23950) sinI 2522870..2523043 (+) 174 WP_014418369.1 anti-repressor SinI family protein Regulator
  BVAD3_RS12050 (BVAD3_23960) sinR 2523077..2523412 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BVAD3_RS12055 (BVAD3_23970) - 2523460..2524245 (-) 786 WP_007408329.1 TasA family protein -
  BVAD3_RS12060 (BVAD3_23980) - 2524310..2524894 (-) 585 WP_012117977.1 signal peptidase I -
  BVAD3_RS12065 (BVAD3_23990) tapA 2524866..2525537 (-) 672 WP_014418371.1 amyloid fiber anchoring/assembly protein TapA -
  BVAD3_RS12070 (BVAD3_24000) - 2525796..2526125 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BVAD3_RS12075 (BVAD3_24010) - 2526166..2526345 (-) 180 WP_003153093.1 YqzE family protein -
  BVAD3_RS12080 (BVAD3_24020) comGG 2526402..2526779 (-) 378 WP_017418138.1 competence type IV pilus minor pilin ComGG Machinery gene
  BVAD3_RS12085 (BVAD3_24030) comGF 2526780..2527175 (-) 396 WP_025649850.1 competence type IV pilus minor pilin ComGF -
  BVAD3_RS12090 (BVAD3_24040) comGE 2527189..2527503 (-) 315 WP_017418140.1 competence type IV pilus minor pilin ComGE Machinery gene
  BVAD3_RS12095 (BVAD3_24050) comGD 2527487..2527924 (-) 438 WP_095061019.1 competence type IV pilus minor pilin ComGD Machinery gene
  BVAD3_RS12100 (BVAD3_24060) comGC 2527914..2528222 (-) 309 WP_014418376.1 competence type IV pilus major pilin ComGC Machinery gene
  BVAD3_RS12105 (BVAD3_24070) comGB 2528227..2529264 (-) 1038 WP_053284924.1 competence type IV pilus assembly protein ComGB Machinery gene
  BVAD3_RS12110 (BVAD3_24080) comGA 2529251..2530321 (-) 1071 WP_014418378.1 competence type IV pilus ATPase ComGA Machinery gene
  BVAD3_RS12115 (BVAD3_24090) - 2530514..2531464 (-) 951 WP_014418379.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 125 a.a.        Molecular weight: 14125.01 Da        Isoelectric Point: 9.7165

>NTDB_id=85436 BVAD3_RS12080 WP_017418138.1 2526402..2526779(-) (comGG) [Bacillus velezensis strain AD-3]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKGQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=85436 BVAD3_RS12080 WP_017418138.1 2526402..2526779(-) (comGG) [Bacillus velezensis strain AD-3]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGGCCAAACTGGTACACAGCGTTTTCCGTACGGCACCGTTTCT
TTTCACATCACCGGGAGTGATCGAAGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGCACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains


Predicted by InterproScan.

(30-124)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512


Multiple sequence alignment