Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BVAD3_RS12045 | Genome accession | NZ_AP024501 |
| Coordinates | 2522870..2523043 (+) | Length | 57 a.a. |
| NCBI ID | WP_014418369.1 | Uniprot ID | I2C7P2 |
| Organism | Bacillus velezensis strain AD-3 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2517870..2528043
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BVAD3_RS12030 (BVAD3_23920) | gcvT | 2518683..2519783 (-) | 1101 | WP_017418134.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BVAD3_RS12035 (BVAD3_23930) | - | 2520207..2521877 (+) | 1671 | WP_021494309.1 | SNF2-related protein | - |
| BVAD3_RS12040 (BVAD3_23940) | - | 2521899..2522693 (+) | 795 | WP_014418368.1 | YqhG family protein | - |
| BVAD3_RS12045 (BVAD3_23950) | sinI | 2522870..2523043 (+) | 174 | WP_014418369.1 | anti-repressor SinI family protein | Regulator |
| BVAD3_RS12050 (BVAD3_23960) | sinR | 2523077..2523412 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BVAD3_RS12055 (BVAD3_23970) | - | 2523460..2524245 (-) | 786 | WP_007408329.1 | TasA family protein | - |
| BVAD3_RS12060 (BVAD3_23980) | - | 2524310..2524894 (-) | 585 | WP_012117977.1 | signal peptidase I | - |
| BVAD3_RS12065 (BVAD3_23990) | tapA | 2524866..2525537 (-) | 672 | WP_014418371.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BVAD3_RS12070 (BVAD3_24000) | - | 2525796..2526125 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BVAD3_RS12075 (BVAD3_24010) | - | 2526166..2526345 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BVAD3_RS12080 (BVAD3_24020) | comGG | 2526402..2526779 (-) | 378 | WP_017418138.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BVAD3_RS12085 (BVAD3_24030) | comGF | 2526780..2527175 (-) | 396 | WP_025649850.1 | competence type IV pilus minor pilin ComGF | - |
| BVAD3_RS12090 (BVAD3_24040) | comGE | 2527189..2527503 (-) | 315 | WP_017418140.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| BVAD3_RS12095 (BVAD3_24050) | comGD | 2527487..2527924 (-) | 438 | WP_095061019.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6642.60 Da Isoelectric Point: 9.8168
>NTDB_id=85434 BVAD3_RS12045 WP_014418369.1 2522870..2523043(+) (sinI) [Bacillus velezensis strain AD-3]
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
MKNAKTEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=85434 BVAD3_RS12045 WP_014418369.1 2522870..2523043(+) (sinI) [Bacillus velezensis strain AD-3]
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAACAGAATTTTCACAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |