Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   QYM39_RS04205 Genome accession   NZ_CP129525
Coordinates   850751..851224 (+) Length   157 a.a.
NCBI ID   WP_260295178.1    Uniprot ID   -
Organism   Pediococcus pentosaceus strain ZZ61     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 840842..878499 850751..851224 within 0


Gene organization within MGE regions


Location: 840842..878499
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYM39_RS04130 (QYM39_04130) - 840842..842014 (-) 1173 WP_301854006.1 site-specific integrase -
  QYM39_RS04135 (QYM39_04135) - 842117..842608 (-) 492 WP_260295155.1 hypothetical protein -
  QYM39_RS04140 (QYM39_04140) - 842691..843704 (-) 1014 WP_260295156.1 DUF3862 domain-containing protein -
  QYM39_RS04145 (QYM39_04145) - 843787..844173 (-) 387 WP_260295157.1 tetratricopeptide repeat protein -
  QYM39_RS04150 (QYM39_04150) - 844694..845101 (-) 408 WP_195753212.1 ImmA/IrrE family metallo-endopeptidase -
  QYM39_RS04155 (QYM39_04155) - 845113..845487 (-) 375 WP_249398716.1 helix-turn-helix transcriptional regulator -
  QYM39_RS04160 (QYM39_04160) - 845658..845876 (+) 219 WP_229564764.1 helix-turn-helix transcriptional regulator -
  QYM39_RS04165 (QYM39_04165) - 845910..846080 (+) 171 WP_195748902.1 hypothetical protein -
  QYM39_RS04170 (QYM39_04170) - 846154..846612 (+) 459 WP_260295165.1 helix-turn-helix domain-containing protein -
  QYM39_RS04175 (QYM39_04175) - 846613..846888 (+) 276 WP_260295167.1 helix-turn-helix domain-containing protein -
  QYM39_RS04180 (QYM39_04180) - 847126..847407 (+) 282 WP_301854014.1 hypothetical protein -
  QYM39_RS04185 (QYM39_04185) - 847400..848251 (+) 852 WP_260295171.1 RecT family recombinase -
  QYM39_RS04190 (QYM39_04190) - 848211..849038 (+) 828 WP_260295173.1 PD-(D/E)XK nuclease-like domain-containing protein -
  QYM39_RS04195 (QYM39_04195) - 849048..849878 (+) 831 WP_260295175.1 helix-turn-helix domain-containing protein -
  QYM39_RS04200 (QYM39_04200) - 849882..850577 (+) 696 WP_260295177.1 putative HNHc nuclease -
  QYM39_RS04205 (QYM39_04205) ssb 850751..851224 (+) 474 WP_260295178.1 single-stranded DNA-binding protein Machinery gene
  QYM39_RS04210 (QYM39_04210) - 851374..851691 (+) 318 WP_260295180.1 DeoR family transcriptional regulator -
  QYM39_RS04215 (QYM39_04215) - 851855..852391 (+) 537 WP_301854023.1 hypothetical protein -
  QYM39_RS04220 (QYM39_04220) - 852468..852926 (+) 459 WP_195751013.1 hypothetical protein -
  QYM39_RS04225 (QYM39_04225) - 852969..853904 (+) 936 WP_195751014.1 hypothetical protein -
  QYM39_RS04230 (QYM39_04230) - 854101..854499 (+) 399 WP_195751015.1 hypothetical protein -
  QYM39_RS04235 (QYM39_04235) - 854624..854977 (+) 354 WP_195751016.1 hypothetical protein -
  QYM39_RS04240 (QYM39_04240) - 855050..855391 (+) 342 WP_195751017.1 phBC6A51 family helix-turn-helix protein -
  QYM39_RS04245 (QYM39_04245) - 855384..856655 (+) 1272 WP_260295396.1 PBSX family phage terminase large subunit -
  QYM39_RS04250 (QYM39_04250) - 856661..858256 (+) 1596 WP_195751018.1 phage portal protein -
  QYM39_RS04255 (QYM39_04255) - 858240..859184 (+) 945 WP_259765510.1 minor capsid protein -
  QYM39_RS04260 (QYM39_04260) - 859240..859398 (+) 159 WP_195751021.1 hypothetical protein -
  QYM39_RS04265 (QYM39_04265) - 859501..860076 (+) 576 WP_195751022.1 DUF4355 domain-containing protein -
  QYM39_RS04270 (QYM39_04270) - 860089..860946 (+) 858 WP_259765511.1 capsid protein -
  QYM39_RS04275 (QYM39_04275) - 860964..861230 (+) 267 WP_195751174.1 Ig-like domain-containing protein -
  QYM39_RS04280 (QYM39_04280) - 861244..861582 (+) 339 WP_260295192.1 phage head-tail connector protein -
  QYM39_RS04285 (QYM39_04285) - 861582..861872 (+) 291 WP_195751025.1 hypothetical protein -
  QYM39_RS04290 (QYM39_04290) - 861869..862225 (+) 357 WP_195751026.1 HK97-gp10 family putative phage morphogenesis protein -
  QYM39_RS04295 (QYM39_04295) - 862323..862586 (+) 264 WP_301854040.1 hypothetical protein -
  QYM39_RS04300 (QYM39_04300) - 862604..863200 (+) 597 WP_195751028.1 phage major tail protein, TP901-1 family -
  QYM39_RS04305 (QYM39_04305) - 863190..863450 (+) 261 WP_195751029.1 Ig-like domain-containing protein -
  QYM39_RS04310 (QYM39_04310) - 863529..863978 (+) 450 WP_195751030.1 tail assembly chaperone -
  QYM39_RS04315 (QYM39_04315) - 864068..864286 (+) 219 WP_195751031.1 hypothetical protein -
  QYM39_RS04320 (QYM39_04320) - 864286..867318 (+) 3033 WP_301854043.1 phage tail tape measure protein -
  QYM39_RS04325 (QYM39_04325) - 867318..868106 (+) 789 WP_301854045.1 hypothetical protein -
  QYM39_RS04330 (QYM39_04330) - 868121..868951 (+) 831 WP_195751032.1 phage tail protein -
  QYM39_RS04335 (QYM39_04335) - 868970..873436 (+) 4467 WP_301854048.1 phage tail protein -
  QYM39_RS04340 (QYM39_04340) - 873433..873672 (+) 240 WP_195751034.1 hypothetical protein -
  QYM39_RS04345 (QYM39_04345) - 873662..874087 (+) 426 WP_195751035.1 hypothetical protein -
  QYM39_RS04350 (QYM39_04350) - 874089..874340 (+) 252 WP_195751036.1 hypothetical protein -
  QYM39_RS04355 (QYM39_04355) - 874374..874892 (+) 519 WP_195751037.1 phage holin family protein -
  QYM39_RS04360 (QYM39_04360) - 874876..875994 (+) 1119 WP_229563985.1 N-acetylmuramoyl-L-alanine amidase -
  QYM39_RS04365 (QYM39_04365) - 877123..878499 (+) 1377 WP_128886915.1 amino acid permease -

Sequence


Protein


Download         Length: 157 a.a.        Molecular weight: 17828.52 Da        Isoelectric Point: 5.9041

>NTDB_id=853897 QYM39_RS04205 WP_260295178.1 850751..851224(+) (ssb) [Pediococcus pentosaceus strain ZZ61]
MINRTVLVGRLTNDPELKYTGNDVAVATFTVAVNRQFTNSQGEREADFIRCQMWRKAAENFCNFTHKGSLVGIDGRIQTR
SYDNQQGTRVFVTEVVAEKFSLLESKNSSQNEQFEQNRPQNNGQNYQNKQNGQSSPSRNPNDLFSSAPQINDDDLPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=853897 QYM39_RS04205 WP_260295178.1 850751..851224(+) (ssb) [Pediococcus pentosaceus strain ZZ61]
ATGATTAATCGAACAGTATTGGTCGGGCGGTTAACTAATGATCCAGAACTAAAATACACAGGCAATGATGTAGCAGTTGC
AACTTTTACAGTAGCCGTAAATCGGCAATTTACTAATTCGCAAGGCGAACGTGAAGCGGATTTTATTAGATGCCAAATGT
GGCGCAAAGCTGCTGAAAACTTCTGTAACTTTACTCACAAAGGTTCACTGGTTGGTATCGATGGCCGGATTCAAACTCGT
TCATACGATAATCAGCAAGGTACACGAGTTTTTGTTACTGAGGTCGTAGCTGAGAAATTCTCACTACTTGAGTCCAAAAA
CAGTAGTCAAAATGAACAATTTGAACAGAATAGACCTCAAAACAATGGACAAAATTATCAGAATAAACAAAATGGTCAAT
CATCACCTAGTAGAAATCCTAATGATCTATTTAGTAGTGCACCACAGATTAACGATGACGATTTACCATTCTAG


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

54.706

100

0.592

  ssbA Bacillus subtilis subsp. subtilis str. 168

52

100

0.58

  ssbB Bacillus subtilis subsp. subtilis str. 168

54.717

67.516

0.369