Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QYC34_RS13955 Genome accession   NZ_CP129338
Coordinates   2591797..2592180 (-) Length   127 a.a.
NCBI ID   WP_046160582.1    Uniprot ID   A0AA96UKP5
Organism   Bacillus subtilis strain SRCM126725     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2586797..2597180
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYC34_RS13915 (QYC34_13915) sinI 2587730..2587903 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  QYC34_RS13920 (QYC34_13920) sinR 2587937..2588272 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QYC34_RS13925 (QYC34_13925) tasA 2588364..2589149 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  QYC34_RS13930 (QYC34_13930) sipW 2589214..2589786 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QYC34_RS13935 (QYC34_13935) tapA 2589770..2590531 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QYC34_RS13940 (QYC34_13940) yqzG 2590803..2591129 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QYC34_RS13945 (QYC34_13945) spoIITA 2591171..2591350 (-) 180 WP_029726723.1 YqzE family protein -
  QYC34_RS13950 (QYC34_13950) comGG 2591422..2591796 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QYC34_RS13955 (QYC34_13955) comGF 2591797..2592180 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  QYC34_RS13960 (QYC34_13960) comGE 2592206..2592553 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene
  QYC34_RS13965 (QYC34_13965) comGD 2592537..2592968 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  QYC34_RS13970 (QYC34_13970) comGC 2592958..2593254 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QYC34_RS13975 (QYC34_13975) comGB 2593268..2594305 (-) 1038 WP_029317912.1 comG operon protein ComGB Machinery gene
  QYC34_RS13980 (QYC34_13980) comGA 2594292..2595362 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QYC34_RS13985 (QYC34_13985) - 2595574..2595771 (-) 198 WP_046160584.1 CBS domain-containing protein -
  QYC34_RS13990 (QYC34_13990) corA 2595773..2596726 (-) 954 WP_046160585.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14306.38 Da        Isoelectric Point: 5.5289

>NTDB_id=852344 QYC34_RS13955 WP_046160582.1 2591797..2592180(-) (comGF) [Bacillus subtilis strain SRCM126725]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYQSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=852344 QYC34_RS13955 WP_046160582.1 2591797..2592180(-) (comGF) [Bacillus subtilis strain SRCM126725]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCAATCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984