Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QYC34_RS13915 Genome accession   NZ_CP129338
Coordinates   2587730..2587903 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain SRCM126725     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2582730..2592903
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QYC34_RS13900 (QYC34_13900) gcvT 2583528..2584616 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  QYC34_RS13905 (QYC34_13905) hepAA 2585058..2586731 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  QYC34_RS13910 (QYC34_13910) yqhG 2586752..2587546 (+) 795 WP_046160581.1 YqhG family protein -
  QYC34_RS13915 (QYC34_13915) sinI 2587730..2587903 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  QYC34_RS13920 (QYC34_13920) sinR 2587937..2588272 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QYC34_RS13925 (QYC34_13925) tasA 2588364..2589149 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  QYC34_RS13930 (QYC34_13930) sipW 2589214..2589786 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QYC34_RS13935 (QYC34_13935) tapA 2589770..2590531 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QYC34_RS13940 (QYC34_13940) yqzG 2590803..2591129 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QYC34_RS13945 (QYC34_13945) spoIITA 2591171..2591350 (-) 180 WP_029726723.1 YqzE family protein -
  QYC34_RS13950 (QYC34_13950) comGG 2591422..2591796 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QYC34_RS13955 (QYC34_13955) comGF 2591797..2592180 (-) 384 WP_046160582.1 ComG operon protein ComGF Machinery gene
  QYC34_RS13960 (QYC34_13960) comGE 2592206..2592553 (-) 348 WP_046160583.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=852341 QYC34_RS13915 WP_014477323.1 2587730..2587903(+) (sinI) [Bacillus subtilis strain SRCM126725]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=852341 QYC34_RS13915 WP_014477323.1 2587730..2587903(+) (sinI) [Bacillus subtilis strain SRCM126725]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982