Detailed information    

insolico Bioinformatically predicted

Overview

Name   comX   Type   Regulator
Locus tag   QWI19_RS16190 Genome accession   NZ_CP129123
Coordinates   3100565..3100732 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain 6D1     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context

Location: 3095565..3105732
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QWI19_RS16160 mrpE 3095958..3096434 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  QWI19_RS16165 mrpF 3096434..3096718 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  QWI19_RS16170 mnhG 3096702..3097076 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  QWI19_RS16175 yuxO 3097117..3097497 (-) 381 WP_017695528.1 hotdog fold thioesterase -
  QWI19_RS16180 comA 3097516..3098160 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QWI19_RS16185 comP 3098241..3100550 (-) 2310 WP_015251333.1 two-component system sensor histidine kinase ComP Regulator
  QWI19_RS16190 comX 3100565..3100732 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  QWI19_RS16195 comQ 3100720..3101619 (-) 900 WP_015251332.1 ComX modifying isoprenyl transferase ComQ Regulator
  QWI19_RS16200 degQ 3101804..3101944 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QWI19_RS16205 - 3102166..3102291 (+) 126 WP_003228793.1 hypothetical protein -
  QWI19_RS16210 - 3102405..3102773 (+) 369 WP_014477834.1 hypothetical protein -
  QWI19_RS16215 pdeH 3102749..3103978 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  QWI19_RS16220 pncB 3104115..3105587 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence

Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=851230 QWI19_RS16190 WP_003242801.1 3100565..3100732(-) (comX) [Bacillus subtilis strain 6D1]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=851230 QWI19_RS16190 WP_003242801.1 3100565..3100732(-) (comX) [Bacillus subtilis strain 6D1]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTTCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1