Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LLUC310_RS11665 | Genome accession | NZ_CP129094 |
| Coordinates | 2133973..2134161 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain UC310 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2128973..2139161
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC310_RS11630 (LLUC310_11710) | - | 2129900..2130709 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLUC310_RS11635 (LLUC310_11715) | - | 2130702..2131439 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLUC310_RS11640 (LLUC310_11720) | - | 2131618..2132460 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLUC310_RS11645 (LLUC310_11725) | - | 2132457..2132894 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC310_RS11650 (LLUC310_11730) | comGG | 2132974..2133336 (-) | 363 | WP_282675947.1 | hypothetical protein | Machinery gene |
| LLUC310_RS11655 (LLUC310_11735) | comGF | 2133296..2133742 (-) | 447 | WP_011836043.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC310_RS11660 (LLUC310_11740) | comGE | 2133705..2133941 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUC310_RS11665 (LLUC310_11745) | comGD | 2133973..2134161 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLUC310_RS11670 (LLUC310_11750) | comGC | 2134363..2134740 (-) | 378 | Protein_2127 | competence type IV pilus major pilin ComGC | - |
| LLUC310_RS11675 (LLUC310_11755) | comGB | 2134758..2135783 (-) | 1026 | WP_282675955.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLUC310_RS11680 (LLUC310_11760) | comGA | 2135683..2136663 (-) | 981 | WP_162494683.1 | competence type IV pilus ATPase ComGA | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=850801 LLUC310_RS11665 WP_014573336.1 2133973..2134161(-) (comGD) [Lactococcus cremoris strain UC310]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=850801 LLUC310_RS11665 WP_014573336.1 2133973..2134161(-) (comGD) [Lactococcus cremoris strain UC310]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |