Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QTN52_RS15905 Genome accession   NZ_CP128551
Coordinates   3188739..3188879 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM123441     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3183739..3193879
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN52_RS15880 (QTN52_15880) - 3184035..3184418 (-) 384 WP_017419422.1 hotdog fold thioesterase -
  QTN52_RS15885 (QTN52_15885) comA 3184440..3185084 (-) 645 WP_014418762.1 response regulator transcription factor Regulator
  QTN52_RS15890 (QTN52_15890) comP 3185165..3187474 (-) 2310 WP_087634938.1 histidine kinase Regulator
  QTN52_RS15895 (QTN52_15895) - 3187494..3187670 (-) 177 WP_087634937.1 competence pheromone ComX -
  QTN52_RS15900 (QTN52_15900) comQ 3187670..3188608 (-) 939 WP_271243340.1 class 1 isoprenoid biosynthesis enzyme Regulator
  QTN52_RS15905 (QTN52_15905) degQ 3188739..3188879 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QTN52_RS15910 (QTN52_15910) - 3189344..3189685 (+) 342 WP_014418765.1 hypothetical protein -
  QTN52_RS15915 (QTN52_15915) - 3189692..3190915 (-) 1224 WP_014418766.1 EAL and HDOD domain-containing protein -
  QTN52_RS15920 (QTN52_15920) - 3191045..3192511 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  QTN52_RS15925 (QTN52_15925) - 3192529..3193080 (-) 552 WP_025853916.1 isochorismatase family cysteine hydrolase -
  QTN52_RS15930 (QTN52_15930) - 3193177..3193575 (-) 399 WP_087634936.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=848876 QTN52_RS15905 WP_003152043.1 3188739..3188879(-) (degQ) [Bacillus velezensis strain SRCM123441]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=848876 QTN52_RS15905 WP_003152043.1 3188739..3188879(-) (degQ) [Bacillus velezensis strain SRCM123441]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891