Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QTN48_RS05185 Genome accession   NZ_CP128503
Coordinates   992200..992340 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain SRCM123422     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 987200..997340
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QTN48_RS05160 (QTN48_05160) - 987503..987901 (+) 399 WP_003152031.1 DUF1694 domain-containing protein -
  QTN48_RS05165 (QTN48_05165) - 987998..988549 (+) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  QTN48_RS05170 (QTN48_05170) - 988567..990033 (+) 1467 WP_106067969.1 nicotinate phosphoribosyltransferase -
  QTN48_RS05175 (QTN48_05175) - 990163..991386 (+) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  QTN48_RS05180 (QTN48_05180) - 991393..991734 (-) 342 WP_181816577.1 hypothetical protein -
  QTN48_RS05185 (QTN48_05185) degQ 992200..992340 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QTN48_RS05190 (QTN48_05190) comQ 992471..993409 (+) 939 WP_289394878.1 class 1 isoprenoid biosynthesis enzyme Regulator
  QTN48_RS05195 (QTN48_05195) - 993409..993585 (+) 177 WP_087634937.1 competence pheromone ComX -
  QTN48_RS05200 (QTN48_05200) comP 993605..995914 (+) 2310 WP_087634938.1 histidine kinase Regulator
  QTN48_RS05205 (QTN48_05205) comA 995995..996639 (+) 645 WP_014418762.1 response regulator transcription factor Regulator
  QTN48_RS05210 (QTN48_05210) - 996661..997044 (+) 384 WP_017419422.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=847901 QTN48_RS05185 WP_003152043.1 992200..992340(+) (degQ) [Bacillus velezensis strain SRCM123422]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=847901 QTN48_RS05185 WP_003152043.1 992200..992340(+) (degQ) [Bacillus velezensis strain SRCM123422]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891