Detailed information    

insolico Bioinformatically predicted

Overview


Name   degQ   Type   Regulator
Locus tag   QRA13_RS16930 Genome accession   NZ_CP128184
Coordinates   3451130..3451270 (+) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain YJ0-1 isolate soil     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context


Location: 3446130..3456270
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRA13_RS16905 (QRA13_16905) - 3446433..3446831 (+) 399 WP_082998524.1 YueI family protein -
  QRA13_RS16910 (QRA13_16910) - 3446928..3447479 (+) 552 WP_224223775.1 isochorismatase family cysteine hydrolase -
  QRA13_RS16915 (QRA13_16915) - 3447497..3448963 (+) 1467 WP_224223774.1 nicotinate phosphoribosyltransferase -
  QRA13_RS16920 (QRA13_16920) - 3449093..3450316 (+) 1224 WP_007613436.1 EAL and HDOD domain-containing protein -
  QRA13_RS16925 (QRA13_16925) - 3450323..3450664 (-) 342 WP_007613435.1 hypothetical protein -
  QRA13_RS16930 (QRA13_16930) degQ 3451130..3451270 (+) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QRA13_RS16935 (QRA13_16935) - 3451401..3452330 (+) 930 WP_224223773.1 polyprenyl synthetase family protein -
  QRA13_RS16940 (QRA13_16940) comX 3452327..3452497 (+) 171 WP_045208751.1 competence pheromone ComX -
  QRA13_RS16945 (QRA13_16945) comP 3452475..3454826 (+) 2352 WP_286279635.1 histidine kinase Regulator
  QRA13_RS16950 (QRA13_16950) comA 3454907..3455551 (+) 645 WP_003152052.1 response regulator transcription factor Regulator
  QRA13_RS16955 (QRA13_16955) - 3455573..3455956 (+) 384 WP_007613430.1 hotdog fold thioesterase -

Sequence


Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=846525 QRA13_RS16930 WP_003152043.1 3451130..3451270(+) (degQ) [Bacillus velezensis strain YJ0-1 isolate soil]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=846525 QRA13_RS16930 WP_003152043.1 3451130..3451270(+) (degQ) [Bacillus velezensis strain YJ0-1 isolate soil]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains


Predicted by InterProScan.

(1-46)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891