Detailed information    

insolico Bioinformatically predicted

Overview

Name   phrC   Type   Regulator
Locus tag   QRA13_RS10340 Genome accession   NZ_CP128184
Coordinates   2149360..2149479 (-) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain YJ0-1 isolate soil     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context

Location: 2144360..2154479
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QRA13_RS10315 (QRA13_10315) - 2144595..2145353 (-) 759 WP_003156330.1 ABC transporter ATP-binding protein -
  QRA13_RS10320 (QRA13_10320) - 2145347..2146294 (-) 948 WP_014416905.1 iron chelate uptake ABC transporter family permease subunit -
  QRA13_RS10325 (QRA13_10325) ceuB 2146284..2147237 (-) 954 WP_032872883.1 ABC transporter permease Machinery gene
  QRA13_RS10330 (QRA13_10330) - 2147651..2149015 (+) 1365 WP_007609394.1 aspartate kinase -
  QRA13_RS10335 (QRA13_10335) - 2149110..2149211 (+) 102 WP_239033885.1 YjcZ family sporulation protein -
  QRA13_RS10340 (QRA13_10340) phrC 2149360..2149479 (-) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  QRA13_RS10345 (QRA13_10345) rapC 2149463..2150611 (-) 1149 WP_029326229.1 Rap family tetratricopeptide repeat protein Regulator
  QRA13_RS10350 (QRA13_10350) - 2150770..2152197 (-) 1428 WP_224224030.1 HAMP domain-containing sensor histidine kinase -
  QRA13_RS10355 (QRA13_10355) - 2152184..2152867 (-) 684 WP_007609386.1 response regulator transcription factor -

Sequence

Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=846501 QRA13_RS10340 WP_003156334.1 2149360..2149479(-) (phrC) [Bacillus velezensis strain YJ0-1 isolate soil]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=846501 QRA13_RS10340 WP_003156334.1 2149360..2149479(-) (phrC) [Bacillus velezensis strain YJ0-1 isolate soil]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGAGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA

Domains

Predicted by InterproScan.

Rap-phr extracellular signalling (PhrC_PhrF)

(3-39)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718