Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | QRS99_RS04060 | Genome accession | NZ_CP127866 |
| Coordinates | 809563..810036 (+) | Length | 157 a.a. |
| NCBI ID | WP_251974454.1 | Uniprot ID | - |
| Organism | Pediococcus pentosaceus strain SMFM2016-NK1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 799316..838512 | 809563..810036 | within | 0 |
Gene organization within MGE regions
Location: 799316..838512
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRS99_RS03970 | - | 799316..800488 (-) | 1173 | WP_195748908.1 | site-specific integrase | - |
| QRS99_RS03975 | - | 800585..800887 (-) | 303 | WP_195748907.1 | hypothetical protein | - |
| QRS99_RS03980 | - | 800976..802046 (-) | 1071 | WP_286121352.1 | DUF4236 domain-containing protein | - |
| QRS99_RS03985 | - | 802160..802621 (-) | 462 | WP_286121354.1 | hypothetical protein | - |
| QRS99_RS03990 | - | 802684..803349 (-) | 666 | WP_286121356.1 | S24 family peptidase | - |
| QRS99_RS03995 | - | 803494..803673 (+) | 180 | WP_286121358.1 | hypothetical protein | - |
| QRS99_RS04000 | - | 803759..803905 (+) | 147 | WP_259763363.1 | hypothetical protein | - |
| QRS99_RS04005 | - | 803902..804168 (-) | 267 | WP_286121361.1 | hypothetical protein | - |
| QRS99_RS04010 | - | 804238..804486 (+) | 249 | WP_286121363.1 | hypothetical protein | - |
| QRS99_RS04015 | - | 804573..804815 (+) | 243 | WP_286121365.1 | hypothetical protein | - |
| QRS99_RS04020 | - | 804889..805347 (+) | 459 | WP_286121367.1 | helix-turn-helix transcriptional regulator | - |
| QRS99_RS04025 | - | 805348..805623 (+) | 276 | WP_159270421.1 | helix-turn-helix domain-containing protein | - |
| QRS99_RS04030 | - | 805861..806142 (+) | 282 | WP_286121369.1 | hypothetical protein | - |
| QRS99_RS04035 | - | 806135..806986 (+) | 852 | WP_138428639.1 | RecT family recombinase | - |
| QRS99_RS04040 | - | 806946..807773 (+) | 828 | WP_159234103.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| QRS99_RS04045 | - | 807783..808610 (+) | 828 | WP_286121372.1 | helix-turn-helix domain-containing protein | - |
| QRS99_RS04050 | - | 808613..809314 (+) | 702 | WP_286121373.1 | putative HNHc nuclease | - |
| QRS99_RS04055 | - | 809283..809543 (+) | 261 | WP_158190602.1 | hypothetical protein | - |
| QRS99_RS04060 | ssb | 809563..810036 (+) | 474 | WP_251974454.1 | single-stranded DNA-binding protein | Machinery gene |
| QRS99_RS04065 | - | 810186..810491 (+) | 306 | WP_286121375.1 | DeoR family transcriptional regulator | - |
| QRS99_RS04070 | - | 810502..810687 (+) | 186 | WP_286121376.1 | hypothetical protein | - |
| QRS99_RS04075 | - | 810699..810923 (+) | 225 | WP_159276385.1 | hypothetical protein | - |
| QRS99_RS04080 | - | 811130..811561 (+) | 432 | WP_286121379.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QRS99_RS04090 | - | 811907..812149 (+) | 243 | WP_286121380.1 | DUF2829 domain-containing protein | - |
| QRS99_RS04095 | - | 812645..812818 (+) | 174 | WP_286121382.1 | hypothetical protein | - |
| QRS99_RS04100 | - | 812818..813318 (+) | 501 | WP_286121384.1 | terminase small subunit | - |
| QRS99_RS04105 | - | 813324..814688 (+) | 1365 | WP_286121462.1 | PBSX family phage terminase large subunit | - |
| QRS99_RS04110 | - | 814691..816238 (+) | 1548 | WP_195751806.1 | phage portal protein | - |
| QRS99_RS04115 | - | 816253..817368 (+) | 1116 | WP_286121386.1 | phage minor capsid protein | - |
| QRS99_RS04120 | - | 817468..818025 (+) | 558 | WP_286121388.1 | phage scaffolding protein | - |
| QRS99_RS04125 | - | 818038..818949 (+) | 912 | WP_259763378.1 | hypothetical protein | - |
| QRS99_RS04130 | - | 819047..819463 (+) | 417 | WP_286121390.1 | hypothetical protein | - |
| QRS99_RS04135 | - | 819460..819807 (+) | 348 | WP_286121392.1 | putative minor capsid protein | - |
| QRS99_RS04140 | - | 819807..820157 (+) | 351 | WP_286121393.1 | minor capsid protein | - |
| QRS99_RS04145 | - | 820144..820539 (+) | 396 | WP_286121395.1 | minor capsid protein | - |
| QRS99_RS04150 | - | 820543..821061 (+) | 519 | WP_286121396.1 | capsid protein | - |
| QRS99_RS04155 | - | 821174..821611 (+) | 438 | WP_286121397.1 | hypothetical protein | - |
| QRS99_RS04160 | - | 821618..822250 (+) | 633 | WP_286121398.1 | Gp15 family bacteriophage protein | - |
| QRS99_RS04165 | - | 822254..827506 (+) | 5253 | WP_286121399.1 | tape measure protein | - |
| QRS99_RS04170 | - | 827559..828356 (+) | 798 | WP_286121401.1 | phage tail domain-containing protein | - |
| QRS99_RS04175 | - | 828365..829501 (+) | 1137 | WP_195751786.1 | phage tail protein | - |
| QRS99_RS04180 | - | 829491..829814 (+) | 324 | WP_195751785.1 | hypothetical protein | - |
| QRS99_RS04185 | - | 829807..830205 (+) | 399 | WP_286121404.1 | hypothetical protein | - |
| QRS99_RS04190 | - | 830195..831232 (+) | 1038 | WP_195751847.1 | BppU family phage baseplate upper protein | - |
| QRS99_RS04195 | - | 831245..832066 (+) | 822 | WP_286121407.1 | collagen-like protein | - |
| QRS99_RS04200 | - | 832078..833568 (+) | 1491 | WP_286121409.1 | hypothetical protein | - |
| QRS99_RS04205 | - | 833644..833916 (+) | 273 | WP_286121411.1 | hypothetical protein | - |
| QRS99_RS04210 | - | 833916..834167 (+) | 252 | WP_286121414.1 | phage holin | - |
| QRS99_RS04215 | - | 834151..835275 (+) | 1125 | WP_286121416.1 | peptidoglycan recognition family protein | - |
| QRS99_RS04220 | - | 835382..836665 (+) | 1284 | WP_286121418.1 | AbiH family protein | - |
| QRS99_RS04225 | - | 837136..838512 (+) | 1377 | WP_115154767.1 | amino acid permease | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17941.62 Da Isoelectric Point: 6.3630
>NTDB_id=844829 QRS99_RS04060 WP_251974454.1 809563..810036(+) (ssb) [Pediococcus pentosaceus strain SMFM2016-NK1]
MINRTVLVGRLTRDPELKYTNSGRAVASFNIAVNRQFTNSQGEREADFINCVIWNKTAENFCNFTRKGSLVGIDGRIQTR
SYENQQGTRIYVTEVVAENFSLLESKNSNQNEQFEQNRPQNNGQNYQNKQNGQSSPSRNPNDPFNSIPDIKDDDLPF
MINRTVLVGRLTRDPELKYTNSGRAVASFNIAVNRQFTNSQGEREADFINCVIWNKTAENFCNFTRKGSLVGIDGRIQTR
SYENQQGTRIYVTEVVAENFSLLESKNSNQNEQFEQNRPQNNGQNYQNKQNGQSSPSRNPNDPFNSIPDIKDDDLPF
Nucleotide
Download Length: 474 bp
>NTDB_id=844829 QRS99_RS04060 WP_251974454.1 809563..810036(+) (ssb) [Pediococcus pentosaceus strain SMFM2016-NK1]
ATGATTAATCGAACTGTTTTAGTTGGCCGGTTGACGCGTGATCCAGAATTGAAATACACCAACAGTGGAAGGGCGGTAGC
TAGCTTTAACATAGCCGTTAACCGTCAATTTACAAATTCACAGGGCGAGCGCGAAGCGGACTTTATTAACTGCGTTATTT
GGAATAAAACGGCGGAAAACTTCTGTAACTTCACTCGCAAAGGGTCACTGGTTGGAATTGATGGACGAATTCAAACTCGA
TCATACGAAAATCAACAAGGAACACGAATTTACGTTACTGAAGTTGTAGCTGAGAACTTCTCGCTACTTGAGTCCAAAAA
CAGTAATCAAAATGAACAATTTGAACAGAATAGGCCTCAAAACAATGGACAAAATTATCAGAATAAACAAAATGGTCAAT
CATCACCTAGCAGAAATCCTAACGACCCATTTAATAGCATACCGGATATCAAGGATGACGATTTACCATTCTAG
ATGATTAATCGAACTGTTTTAGTTGGCCGGTTGACGCGTGATCCAGAATTGAAATACACCAACAGTGGAAGGGCGGTAGC
TAGCTTTAACATAGCCGTTAACCGTCAATTTACAAATTCACAGGGCGAGCGCGAAGCGGACTTTATTAACTGCGTTATTT
GGAATAAAACGGCGGAAAACTTCTGTAACTTCACTCGCAAAGGGTCACTGGTTGGAATTGATGGACGAATTCAAACTCGA
TCATACGAAAATCAACAAGGAACACGAATTTACGTTACTGAAGTTGTAGCTGAGAACTTCTCGCTACTTGAGTCCAAAAA
CAGTAATCAAAATGAACAATTTGAACAGAATAGGCCTCAAAACAATGGACAAAATTATCAGAATAAACAAAATGGTCAAT
CATCACCTAGCAGAAATCCTAACGACCCATTTAATAGCATACCGGATATCAAGGATGACGATTTACCATTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.824 |
100 |
0.637 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.705 |
100 |
0.58 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
67.516 |
0.382 |