Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QQZ05_RS12570 | Genome accession | NZ_CP127100 |
| Coordinates | 2656404..2656910 (-) | Length | 168 a.a. |
| NCBI ID | WP_014614920.1 | Uniprot ID | A0A161W350 |
| Organism | Staphylococcus pseudintermedius strain 6127-64107 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2592146..2660883 | 2656404..2656910 | within | 0 |
Gene organization within MGE regions
Location: 2592146..2660883
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQZ05_RS12285 (QQZ05_12285) | - | 2592146..2593588 (+) | 1443 | WP_000790705.1 | Mu transposase C-terminal domain-containing protein | - |
| QQZ05_RS12290 (QQZ05_12290) | - | 2593581..2594396 (+) | 816 | WP_000164963.1 | AAA family ATPase | - |
| QQZ05_RS12295 (QQZ05_12295) | - | 2594648..2595838 (-) | 1191 | WP_014614875.1 | MFS transporter | - |
| QQZ05_RS12300 (QQZ05_12300) | - | 2595850..2596590 (-) | 741 | WP_014614876.1 | ABC transporter ATP-binding protein | - |
| QQZ05_RS12305 (QQZ05_12305) | - | 2596584..2597402 (-) | 819 | WP_014614877.1 | ABC transporter ATP-binding protein | - |
| QQZ05_RS12310 (QQZ05_12310) | opp1C | 2597402..2598265 (-) | 864 | WP_014614878.1 | nickel/cobalt ABC transporter permease | - |
| QQZ05_RS12315 (QQZ05_12315) | opp1B | 2598267..2599199 (-) | 933 | WP_015728548.1 | nickel/cobalt ABC transporter permease | - |
| QQZ05_RS12320 (QQZ05_12320) | nikA | 2599212..2600813 (-) | 1602 | WP_100006660.1 | nickel ABC transporter substrate-binding protein | - |
| QQZ05_RS12325 (QQZ05_12325) | cntM | 2601048..2602343 (-) | 1296 | WP_014614881.1 | staphylopine biosynthesis dehydrogenase | - |
| QQZ05_RS12330 (QQZ05_12330) | cntL | 2602346..2603164 (-) | 819 | WP_100006661.1 | staphylopine biosynthesis enzyme CntL | - |
| QQZ05_RS12335 (QQZ05_12335) | cntK | 2603174..2603983 (-) | 810 | WP_100006662.1 | histidine racemase CntK | - |
| QQZ05_RS12340 (QQZ05_12340) | - | 2604349..2605071 (-) | 723 | WP_014614884.1 | hypothetical protein | - |
| QQZ05_RS12345 (QQZ05_12345) | - | 2605415..2606152 (+) | 738 | WP_225549879.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| QQZ05_RS12350 (QQZ05_12350) | - | 2606158..2607543 (+) | 1386 | WP_014614886.1 | APC family permease | - |
| QQZ05_RS12355 (QQZ05_12355) | - | 2607787..2609841 (-) | 2055 | WP_285534291.1 | YSIRK-type signal peptide-containing protein | - |
| QQZ05_RS12360 (QQZ05_12360) | spsN | 2610500..2612452 (-) | 1953 | WP_285534292.1 | LPXTG-anchored surface protein SpsN | - |
| QQZ05_RS12365 (QQZ05_12365) | - | 2613296..2614297 (+) | 1002 | WP_233506563.1 | thermonuclease family protein | - |
| QQZ05_RS12370 (QQZ05_12370) | - | 2614707..2615621 (+) | 915 | WP_014614890.1 | TDT family transporter | - |
| QQZ05_RS12375 (QQZ05_12375) | - | 2616029..2616880 (-) | 852 | WP_159461111.1 | Abi family protein | - |
| QQZ05_RS12380 (QQZ05_12380) | - | 2617451..2617594 (+) | 144 | Protein_2390 | site-specific integrase | - |
| QQZ05_RS12385 (QQZ05_12385) | - | 2618188..2618733 (-) | 546 | WP_285534293.1 | hypothetical protein | - |
| QQZ05_RS12390 (QQZ05_12390) | - | 2618963..2619160 (-) | 198 | WP_214530900.1 | hypothetical protein | - |
| QQZ05_RS12395 (QQZ05_12395) | - | 2619400..2619651 (-) | 252 | WP_179294165.1 | hypothetical protein | - |
| QQZ05_RS12400 (QQZ05_12400) | - | 2619844..2620278 (+) | 435 | WP_203157344.1 | hypothetical protein | - |
| QQZ05_RS12410 (QQZ05_12410) | - | 2620538..2621674 (+) | 1137 | Protein_2395 | site-specific integrase | - |
| QQZ05_RS12415 (QQZ05_12415) | guaA | 2621757..2623298 (-) | 1542 | WP_014614896.1 | glutamine-hydrolyzing GMP synthase | - |
| QQZ05_RS12420 (QQZ05_12420) | guaB | 2623321..2624787 (-) | 1467 | WP_014614897.1 | IMP dehydrogenase | - |
| QQZ05_RS12425 (QQZ05_12425) | pbuX | 2624825..2626093 (-) | 1269 | WP_014614898.1 | xanthine permease PbuX | - |
| QQZ05_RS12430 (QQZ05_12430) | xpt | 2626090..2626674 (-) | 585 | WP_014614899.1 | xanthine phosphoribosyltransferase | - |
| QQZ05_RS12435 (QQZ05_12435) | - | 2627135..2627557 (+) | 423 | WP_014614900.1 | general stress protein | - |
| QQZ05_RS12440 (QQZ05_12440) | - | 2627753..2628427 (+) | 675 | WP_115807382.1 | hypothetical protein | - |
| QQZ05_RS12445 (QQZ05_12445) | - | 2628541..2629140 (+) | 600 | WP_014614902.1 | hypothetical protein | - |
| QQZ05_RS12450 (QQZ05_12450) | thiO | 2629414..2630520 (+) | 1107 | WP_015728532.1 | glycine oxidase ThiO | - |
| QQZ05_RS12455 (QQZ05_12455) | - | 2630595..2631986 (+) | 1392 | WP_015728531.1 | L-cystine transporter | - |
| QQZ05_RS12460 (QQZ05_12460) | - | 2632080..2632724 (-) | 645 | WP_198456101.1 | ATP-binding cassette domain-containing protein | - |
| QQZ05_RS12465 (QQZ05_12465) | - | 2632721..2633047 (-) | 327 | WP_242062912.1 | YxeA family protein | - |
| QQZ05_RS12470 (QQZ05_12470) | - | 2633051..2635018 (-) | 1968 | WP_198456102.1 | DUF1430 domain-containing protein | - |
| QQZ05_RS12475 (QQZ05_12475) | nfsA | 2635276..2636031 (-) | 756 | WP_015728527.1 | oxygen-insensitive NADPH nitroreductase | - |
| QQZ05_RS12480 (QQZ05_12480) | ahpC | 2636584..2637153 (+) | 570 | WP_014614909.1 | alkyl hydroperoxide reductase subunit C | - |
| QQZ05_RS12485 (QQZ05_12485) | ahpF | 2637168..2638691 (+) | 1524 | WP_015728526.1 | alkyl hydroperoxide reductase subunit F | - |
| QQZ05_RS12490 (QQZ05_12490) | - | 2638892..2639833 (-) | 942 | WP_285534294.1 | DUF1002 domain-containing protein | - |
| QQZ05_RS12495 (QQZ05_12495) | bioB | 2639951..2640940 (-) | 990 | WP_014614912.1 | biotin synthase BioB | - |
| QQZ05_RS12500 (QQZ05_12500) | - | 2641146..2641523 (+) | 378 | WP_063279066.1 | DUF1801 domain-containing protein | - |
| QQZ05_RS12505 (QQZ05_12505) | - | 2641840..2642865 (+) | 1026 | WP_014614914.1 | ATP-binding cassette domain-containing protein | - |
| QQZ05_RS12510 (QQZ05_12510) | - | 2642859..2643518 (+) | 660 | WP_014614915.1 | methionine ABC transporter permease | - |
| QQZ05_RS12515 (QQZ05_12515) | gmpC | 2643534..2644373 (+) | 840 | WP_014614916.1 | dipeptide ABC transporter glycylmethionine-binding lipoprotein | - |
| QQZ05_RS12520 (QQZ05_12520) | - | 2644642..2645841 (+) | 1200 | WP_282097302.1 | IS110 family transposase | - |
| QQZ05_RS12525 (QQZ05_12525) | add | 2646100..2647095 (-) | 996 | WP_063278727.1 | adenosine deaminase | - |
| QQZ05_RS12530 (QQZ05_12530) | - | 2647489..2649480 (+) | 1992 | WP_063278726.1 | catalase | - |
| QQZ05_RS12535 (QQZ05_12535) | ugpC | 2649546..2650655 (-) | 1110 | WP_063278725.1 | sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC | - |
| QQZ05_RS12540 (QQZ05_12540) | - | 2650774..2651895 (-) | 1122 | WP_285534295.1 | Gfo/Idh/MocA family oxidoreductase | - |
| QQZ05_RS12545 (QQZ05_12545) | - | 2651910..2652737 (-) | 828 | WP_063278723.1 | carbohydrate ABC transporter permease | - |
| QQZ05_RS12550 (QQZ05_12550) | - | 2652739..2653638 (-) | 900 | WP_110144927.1 | sugar ABC transporter permease | - |
| QQZ05_RS12555 (QQZ05_12555) | - | 2653648..2654973 (-) | 1326 | WP_110144928.1 | sugar ABC transporter substrate-binding protein | - |
| QQZ05_RS12560 (QQZ05_12560) | - | 2655077..2655907 (-) | 831 | WP_070407296.1 | AraC family transcriptional regulator | - |
| QQZ05_RS12565 (QQZ05_12565) | rpsR | 2656108..2656350 (-) | 243 | WP_014614919.1 | 30S ribosomal protein S18 | - |
| QQZ05_RS12570 (QQZ05_12570) | ssbA | 2656404..2656910 (-) | 507 | WP_014614920.1 | single-stranded DNA-binding protein | Machinery gene |
| QQZ05_RS12575 (QQZ05_12575) | rpsF | 2656933..2657229 (-) | 297 | WP_014614921.1 | 30S ribosomal protein S6 | - |
| QQZ05_RS12580 (QQZ05_12580) | sbi | 2657566..2659092 (+) | 1527 | WP_015728518.1 | Ig-binding surface protein Sbi/SpsK | - |
| QQZ05_RS12585 (QQZ05_12585) | - | 2659146..2659955 (-) | 810 | WP_037541946.1 | ABC transporter permease subunit | - |
| QQZ05_RS12590 (QQZ05_12590) | - | 2659948..2660883 (-) | 936 | WP_063278718.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 168 a.a. Molecular weight: 18738.42 Da Isoelectric Point: 5.1957
>NTDB_id=841799 QQZ05_RS12570 WP_014614920.1 2656404..2656910(-) (ssbA) [Staphylococcus pseudintermedius strain 6127-64107]
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRKQAENVNNFLFKGSLAGVDGRLQSR
SYENQEGRRVFVTEVVCDSVQFLEPKSQNQRHANQNQGNQFDSYGQGFGGQQQGQNSSYQNNHQQPANDNPFANANGPID
ISDDDLPF
MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRKQAENVNNFLFKGSLAGVDGRLQSR
SYENQEGRRVFVTEVVCDSVQFLEPKSQNQRHANQNQGNQFDSYGQGFGGQQQGQNSSYQNNHQQPANDNPFANANGPID
ISDDDLPF
Nucleotide
Download Length: 507 bp
>NTDB_id=841799 QQZ05_RS12570 WP_014614920.1 2656404..2656910(-) (ssbA) [Staphylococcus pseudintermedius strain 6127-64107]
ATGCTTAATAGAGTCGTATTAGTAGGTCGCTTAACTAAAGATCCAGAATACAGAACGACACCCTCAGGCGTAAGTGTAGC
GACATTTACCTTAGCGGTTAATCGTACATTTACGAATGCGCAAGGGGAACGTGAAGCAGACTTCATTAACTGCGTTGTTT
TCCGTAAACAAGCAGAAAATGTAAACAACTTTTTGTTTAAAGGAAGTCTCGCTGGCGTTGACGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTGTATTCGTCACTGAAGTGGTATGTGATAGTGTTCAATTCCTTGAGCCAAAATC
ACAAAACCAACGTCACGCGAATCAAAACCAAGGCAATCAATTCGATAGCTACGGTCAAGGATTCGGTGGACAACAACAAG
GCCAAAATTCGTCTTATCAAAACAATCATCAGCAACCAGCTAACGATAACCCATTTGCGAATGCGAACGGTCCTATCGAT
ATTAGCGATGATGATTTACCATTCTAA
ATGCTTAATAGAGTCGTATTAGTAGGTCGCTTAACTAAAGATCCAGAATACAGAACGACACCCTCAGGCGTAAGTGTAGC
GACATTTACCTTAGCGGTTAATCGTACATTTACGAATGCGCAAGGGGAACGTGAAGCAGACTTCATTAACTGCGTTGTTT
TCCGTAAACAAGCAGAAAATGTAAACAACTTTTTGTTTAAAGGAAGTCTCGCTGGCGTTGACGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTGTATTCGTCACTGAAGTGGTATGTGATAGTGTTCAATTCCTTGAGCCAAAATC
ACAAAACCAACGTCACGCGAATCAAAACCAAGGCAATCAATTCGATAGCTACGGTCAAGGATTCGGTGGACAACAACAAG
GCCAAAATTCGTCTTATCAAAACAATCATCAGCAACCAGCTAACGATAACCCATTTGCGAATGCGAACGGTCCTATCGAT
ATTAGCGATGATGATTTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
64.773 |
100 |
0.679 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.14 |
100 |
0.571 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.182 |
65.476 |
0.381 |