Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QMC72_RS10765 Genome accession   NZ_CP127095
Coordinates   2044152..2044292 (+) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus inaquosorum strain LBA001     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2039152..2049292
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMC72_RS10735 (QMC72_10735) - 2039447..2039845 (+) 399 WP_019259337.1 YueI family protein -
  QMC72_RS10740 (QMC72_10740) - 2039942..2040493 (+) 552 WP_060399392.1 isochorismatase family cysteine hydrolase -
  QMC72_RS10745 (QMC72_10745) - 2040509..2041981 (+) 1473 WP_060399391.1 nicotinate phosphoribosyltransferase -
  QMC72_RS10750 (QMC72_10750) pdeH 2042119..2043348 (+) 1230 WP_133486196.1 cyclic di-GMP phosphodiesterase -
  QMC72_RS10755 (QMC72_10755) - 2043324..2043692 (-) 369 WP_084991317.1 hypothetical protein -
  QMC72_RS10760 (QMC72_10760) - 2043805..2043972 (-) 168 WP_119914210.1 hypothetical protein -
  QMC72_RS10765 (QMC72_10765) degQ 2044152..2044292 (+) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QMC72_RS10770 (QMC72_10770) - 2044477..2045337 (+) 861 WP_148982767.1 polyprenyl synthetase family protein -
  QMC72_RS10775 (QMC72_10775) comX 2045350..2045514 (+) 165 WP_015384519.1 competence pheromone ComX -
  QMC72_RS10780 (QMC72_10780) comP 2045526..2047826 (+) 2301 WP_119914209.1 histidine kinase Regulator
  QMC72_RS10785 (QMC72_10785) comA 2047907..2048551 (+) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QMC72_RS10790 (QMC72_10790) - 2048570..2048950 (+) 381 WP_284106914.1 hotdog fold thioesterase -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=841685 QMC72_RS10765 WP_003220708.1 2044152..2044292(+) (degQ) [Bacillus inaquosorum strain LBA001]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=841685 QMC72_RS10765 WP_003220708.1 2044152..2044292(+) (degQ) [Bacillus inaquosorum strain LBA001]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACAACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACAATTACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1