Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | QMC72_RS03200 | Genome accession | NZ_CP127095 |
| Coordinates | 594700..594873 (-) | Length | 57 a.a. |
| NCBI ID | WP_003226347.1 | Uniprot ID | G4NQ83 |
| Organism | Bacillus inaquosorum strain LBA001 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 589700..599873
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QMC72_RS03155 (QMC72_03155) | comGE | 590045..590392 (+) | 348 | WP_133486963.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| QMC72_RS03160 (QMC72_03160) | comGF | 590418..590801 (+) | 384 | WP_133486965.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| QMC72_RS03165 (QMC72_03165) | comGG | 590802..591176 (+) | 375 | WP_284107348.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| QMC72_RS03170 (QMC72_03170) | - | 591247..591426 (+) | 180 | WP_003236949.1 | YqzE family protein | - |
| QMC72_RS03175 (QMC72_03175) | - | 591468..591794 (-) | 327 | WP_029316858.1 | YqzG/YhdC family protein | - |
| QMC72_RS03180 (QMC72_03180) | tapA | 592067..592831 (+) | 765 | WP_133486967.1 | amyloid fiber anchoring/assembly protein TapA | - |
| QMC72_RS03185 (QMC72_03185) | sipW | 592815..593387 (+) | 573 | WP_133487330.1 | signal peptidase I SipW | - |
| QMC72_RS03190 (QMC72_03190) | tasA | 593451..594236 (+) | 786 | WP_003236939.1 | biofilm matrix protein TasA | - |
| QMC72_RS03195 (QMC72_03195) | sinR | 594331..594666 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| QMC72_RS03200 (QMC72_03200) | sinI | 594700..594873 (-) | 174 | WP_003226347.1 | anti-repressor SinI | Regulator |
| QMC72_RS03205 (QMC72_03205) | - | 595058..595852 (-) | 795 | WP_133486969.1 | YqhG family protein | - |
| QMC72_RS03210 (QMC72_03210) | - | 595873..597546 (-) | 1674 | WP_003236934.1 | SNF2-related protein | - |
| QMC72_RS03215 (QMC72_03215) | gcvT | 597990..599078 (+) | 1089 | WP_133486971.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6632.64 Da Isoelectric Point: 8.6596
>NTDB_id=841666 QMC72_RS03200 WP_003226347.1 594700..594873(-) (sinI) [Bacillus inaquosorum strain LBA001]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=841666 QMC72_RS03200 WP_003226347.1 594700..594873(-) (sinI) [Bacillus inaquosorum strain LBA001]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
96.491 |
100 |
0.965 |