Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QMC72_RS03200 Genome accession   NZ_CP127095
Coordinates   594700..594873 (-) Length   57 a.a.
NCBI ID   WP_003226347.1    Uniprot ID   G4NQ83
Organism   Bacillus inaquosorum strain LBA001     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 589700..599873
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMC72_RS03155 (QMC72_03155) comGE 590045..590392 (+) 348 WP_133486963.1 competence type IV pilus minor pilin ComGE Machinery gene
  QMC72_RS03160 (QMC72_03160) comGF 590418..590801 (+) 384 WP_133486965.1 competence type IV pilus minor pilin ComGF Machinery gene
  QMC72_RS03165 (QMC72_03165) comGG 590802..591176 (+) 375 WP_284107348.1 competence type IV pilus minor pilin ComGG Machinery gene
  QMC72_RS03170 (QMC72_03170) - 591247..591426 (+) 180 WP_003236949.1 YqzE family protein -
  QMC72_RS03175 (QMC72_03175) - 591468..591794 (-) 327 WP_029316858.1 YqzG/YhdC family protein -
  QMC72_RS03180 (QMC72_03180) tapA 592067..592831 (+) 765 WP_133486967.1 amyloid fiber anchoring/assembly protein TapA -
  QMC72_RS03185 (QMC72_03185) sipW 592815..593387 (+) 573 WP_133487330.1 signal peptidase I SipW -
  QMC72_RS03190 (QMC72_03190) tasA 593451..594236 (+) 786 WP_003236939.1 biofilm matrix protein TasA -
  QMC72_RS03195 (QMC72_03195) sinR 594331..594666 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QMC72_RS03200 (QMC72_03200) sinI 594700..594873 (-) 174 WP_003226347.1 anti-repressor SinI Regulator
  QMC72_RS03205 (QMC72_03205) - 595058..595852 (-) 795 WP_133486969.1 YqhG family protein -
  QMC72_RS03210 (QMC72_03210) - 595873..597546 (-) 1674 WP_003236934.1 SNF2-related protein -
  QMC72_RS03215 (QMC72_03215) gcvT 597990..599078 (+) 1089 WP_133486971.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6632.64 Da        Isoelectric Point: 8.6596

>NTDB_id=841666 QMC72_RS03200 WP_003226347.1 594700..594873(-) (sinI) [Bacillus inaquosorum strain LBA001]
MKNAKQEHFELDQEWVELMMKAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=841666 QMC72_RS03200 WP_003226347.1 594700..594873(-) (sinI) [Bacillus inaquosorum strain LBA001]
ATGAAAAATGCAAAACAAGAGCACTTCGAATTAGATCAAGAATGGGTTGAATTAATGATGAAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

96.491

100

0.965