Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   QMC72_RS03155 Genome accession   NZ_CP127095
Coordinates   590045..590392 (+) Length   115 a.a.
NCBI ID   WP_133486963.1    Uniprot ID   A0A9Q4HTN7
Organism   Bacillus inaquosorum strain LBA001     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 585045..595392
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMC72_RS03125 (QMC72_03125) corA 585604..586548 (+) 945 WP_284107350.1 magnesium transporter CorA -
  QMC72_RS03130 (QMC72_03130) - 586611..587021 (+) 411 WP_268276765.1 CBS domain-containing protein -
  QMC72_RS03135 (QMC72_03135) comGA 587236..588306 (+) 1071 WP_133486954.1 competence protein ComGA Machinery gene
  QMC72_RS03140 (QMC72_03140) comGB 588293..589330 (+) 1038 WP_148981974.1 competence type IV pilus assembly protein ComGB Machinery gene
  QMC72_RS03145 (QMC72_03145) comGC 589344..589640 (+) 297 WP_003236957.1 comG operon protein ComGC Machinery gene
  QMC72_RS03150 (QMC72_03150) comGD 589630..590061 (+) 432 WP_284107349.1 competence type IV pilus minor pilin ComGD Machinery gene
  QMC72_RS03155 (QMC72_03155) comGE 590045..590392 (+) 348 WP_133486963.1 competence type IV pilus minor pilin ComGE Machinery gene
  QMC72_RS03160 (QMC72_03160) comGF 590418..590801 (+) 384 WP_133486965.1 competence type IV pilus minor pilin ComGF Machinery gene
  QMC72_RS03165 (QMC72_03165) comGG 590802..591176 (+) 375 WP_284107348.1 competence type IV pilus minor pilin ComGG Machinery gene
  QMC72_RS03170 (QMC72_03170) - 591247..591426 (+) 180 WP_003236949.1 YqzE family protein -
  QMC72_RS03175 (QMC72_03175) - 591468..591794 (-) 327 WP_029316858.1 YqzG/YhdC family protein -
  QMC72_RS03180 (QMC72_03180) tapA 592067..592831 (+) 765 WP_133486967.1 amyloid fiber anchoring/assembly protein TapA -
  QMC72_RS03185 (QMC72_03185) sipW 592815..593387 (+) 573 WP_133487330.1 signal peptidase I SipW -
  QMC72_RS03190 (QMC72_03190) tasA 593451..594236 (+) 786 WP_003236939.1 biofilm matrix protein TasA -
  QMC72_RS03195 (QMC72_03195) sinR 594331..594666 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QMC72_RS03200 (QMC72_03200) sinI 594700..594873 (-) 174 WP_003226347.1 anti-repressor SinI Regulator

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13283.27 Da        Isoelectric Point: 4.5188

>NTDB_id=841662 QMC72_RS03155 WP_133486963.1 590045..590392(+) (comGE) [Bacillus inaquosorum strain LBA001]
MWRENKGFSTIETMSALSLWLFLMLTVVPLWDKLIADENMAESREIGYQLMNESISKYMMTGEGAASKTVTKNNNIYTLK
WEEEGEYQNVCISAAAYKEKPFCLSILRTDWLYAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=841662 QMC72_RS03155 WP_133486963.1 590045..590392(+) (comGE) [Bacillus inaquosorum strain LBA001]
ATGTGGAGAGAAAATAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTGTGGCTGTTTCTGATGCTGACAGT
CGTTCCCTTGTGGGACAAGCTGATAGCTGATGAAAATATGGCGGAATCACGAGAAATCGGCTACCAGTTAATGAATGAAA
GTATTAGCAAATATATGATGACTGGTGAAGGAGCTGCGTCAAAAACGGTTACAAAGAACAATAATATCTATACGCTGAAG
TGGGAGGAGGAGGGAGAATATCAAAACGTATGCATCTCAGCAGCAGCATATAAAGAAAAACCATTTTGCCTCAGCATTCT
GCGGACAGACTGGCTATACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

86.087

100

0.861