Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QQW97_RS12855 Genome accession   NZ_CP127089
Coordinates   2399258..2399641 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis strain KK026     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2394258..2404641
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QQW97_RS12815 (QQW97_12810) sinI 2395192..2395365 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QQW97_RS12820 (QQW97_12815) sinR 2395399..2395734 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QQW97_RS12825 (QQW97_12820) tasA 2395827..2396612 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  QQW97_RS12830 (QQW97_12825) sipW 2396676..2397248 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QQW97_RS12835 (QQW97_12830) tapA 2397232..2397993 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  QQW97_RS12840 (QQW97_12835) yqzG 2398265..2398591 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QQW97_RS12845 (QQW97_12840) spoIITA 2398633..2398812 (-) 180 WP_003230176.1 YqzE family protein -
  QQW97_RS12850 (QQW97_12845) comGG 2398883..2399257 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  QQW97_RS12855 (QQW97_12850) comGF 2399258..2399641 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  QQW97_RS12860 (QQW97_12855) comGE 2399667..2400014 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  QQW97_RS12865 (QQW97_12860) comGD 2399998..2400429 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  QQW97_RS12870 (QQW97_12865) comGC 2400419..2400715 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QQW97_RS12875 (QQW97_12870) comGB 2400729..2401766 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  QQW97_RS12880 (QQW97_12875) comGA 2401753..2402823 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QQW97_RS12885 (QQW97_12880) corA 2403235..2404188 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=841536 QQW97_RS12855 WP_003230168.1 2399258..2399641(-) (comGF) [Bacillus subtilis strain KK026]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=841536 QQW97_RS12855 WP_003230168.1 2399258..2399641(-) (comGF) [Bacillus subtilis strain KK026]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1