Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QQW97_RS12815 Genome accession   NZ_CP127089
Coordinates   2395192..2395365 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain KK026     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2390192..2400365
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QQW97_RS12800 (QQW97_12795) gcvT 2390991..2392079 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  QQW97_RS12805 (QQW97_12800) hepAA 2392521..2394194 (+) 1674 WP_004398544.1 DEAD/DEAH box helicase -
  QQW97_RS12810 (QQW97_12805) yqhG 2394215..2395009 (+) 795 WP_003230200.1 YqhG family protein -
  QQW97_RS12815 (QQW97_12810) sinI 2395192..2395365 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QQW97_RS12820 (QQW97_12815) sinR 2395399..2395734 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QQW97_RS12825 (QQW97_12820) tasA 2395827..2396612 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  QQW97_RS12830 (QQW97_12825) sipW 2396676..2397248 (-) 573 WP_003246088.1 signal peptidase I SipW -
  QQW97_RS12835 (QQW97_12830) tapA 2397232..2397993 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  QQW97_RS12840 (QQW97_12835) yqzG 2398265..2398591 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QQW97_RS12845 (QQW97_12840) spoIITA 2398633..2398812 (-) 180 WP_003230176.1 YqzE family protein -
  QQW97_RS12850 (QQW97_12845) comGG 2398883..2399257 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  QQW97_RS12855 (QQW97_12850) comGF 2399258..2399641 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  QQW97_RS12860 (QQW97_12855) comGE 2399667..2400014 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=841533 QQW97_RS12815 WP_003230187.1 2395192..2395365(+) (sinI) [Bacillus subtilis strain KK026]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=841533 QQW97_RS12815 WP_003230187.1 2395192..2395365(+) (sinI) [Bacillus subtilis strain KK026]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1