Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | QQF37_RS10705 | Genome accession | NZ_CP126986 |
| Coordinates | 2274395..2274568 (+) | Length | 57 a.a. |
| NCBI ID | WP_032874029.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain MC2S-6 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2269395..2279568
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQF37_RS10690 (QQF37_10690) | gcvT | 2270209..2271309 (-) | 1101 | WP_032874033.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| QQF37_RS10695 (QQF37_10695) | - | 2271732..2273402 (+) | 1671 | WP_032874031.1 | SNF2-related protein | - |
| QQF37_RS10700 (QQF37_10700) | - | 2273424..2274218 (+) | 795 | WP_007612541.1 | YqhG family protein | - |
| QQF37_RS10705 (QQF37_10705) | sinI | 2274395..2274568 (+) | 174 | WP_032874029.1 | anti-repressor SinI | Regulator |
| QQF37_RS10710 (QQF37_10710) | sinR | 2274602..2274937 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| QQF37_RS10715 (QQF37_10715) | - | 2274985..2275770 (-) | 786 | WP_032874027.1 | biofilm matrix protein TasA | - |
| QQF37_RS10720 (QQF37_10720) | - | 2275835..2276419 (-) | 585 | WP_032874025.1 | signal peptidase I SipW | - |
| QQF37_RS10725 (QQF37_10725) | tapA | 2276391..2277062 (-) | 672 | WP_032874023.1 | amyloid fiber anchoring/assembly protein TapA | - |
| QQF37_RS10730 (QQF37_10730) | - | 2277321..2277650 (+) | 330 | WP_032874021.1 | DUF3889 domain-containing protein | - |
| QQF37_RS10735 (QQF37_10735) | - | 2277691..2277870 (-) | 180 | WP_022552966.1 | YqzE family protein | - |
| QQF37_RS10740 (QQF37_10740) | comGG | 2277927..2278304 (-) | 378 | WP_032874019.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| QQF37_RS10745 (QQF37_10745) | comGF | 2278305..2278805 (-) | 501 | WP_223204419.1 | competence type IV pilus minor pilin ComGF | - |
| QQF37_RS10750 (QQF37_10750) | comGE | 2278714..2279028 (-) | 315 | WP_032874016.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| QQF37_RS10755 (QQF37_10755) | comGD | 2279012..2279449 (-) | 438 | WP_007612572.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6658.66 Da Isoelectric Point: 9.8168
>NTDB_id=841051 QQF37_RS10705 WP_032874029.1 2274395..2274568(+) (sinI) [Bacillus velezensis strain MC2S-6]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSNKKSSQHVQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=841051 QQF37_RS10705 WP_032874029.1 2274395..2274568(+) (sinI) [Bacillus velezensis strain MC2S-6]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGAATAAAAAGTCTTCTCAACATGTCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
71.93 |
100 |
0.719 |