Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   QQF37_RS10750 Genome accession   NZ_CP126986
Coordinates   2278714..2279028 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus velezensis strain MC2S-6     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2273714..2284028
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QQF37_RS10705 (QQF37_10705) sinI 2274395..2274568 (+) 174 WP_032874029.1 anti-repressor SinI Regulator
  QQF37_RS10710 (QQF37_10710) sinR 2274602..2274937 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QQF37_RS10715 (QQF37_10715) - 2274985..2275770 (-) 786 WP_032874027.1 biofilm matrix protein TasA -
  QQF37_RS10720 (QQF37_10720) - 2275835..2276419 (-) 585 WP_032874025.1 signal peptidase I SipW -
  QQF37_RS10725 (QQF37_10725) tapA 2276391..2277062 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  QQF37_RS10730 (QQF37_10730) - 2277321..2277650 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  QQF37_RS10735 (QQF37_10735) - 2277691..2277870 (-) 180 WP_022552966.1 YqzE family protein -
  QQF37_RS10740 (QQF37_10740) comGG 2277927..2278304 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  QQF37_RS10745 (QQF37_10745) comGF 2278305..2278805 (-) 501 WP_223204419.1 competence type IV pilus minor pilin ComGF -
  QQF37_RS10750 (QQF37_10750) comGE 2278714..2279028 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  QQF37_RS10755 (QQF37_10755) comGD 2279012..2279449 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  QQF37_RS10760 (QQF37_10760) comGC 2279439..2279705 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  QQF37_RS10765 (QQF37_10765) comGB 2279752..2280789 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  QQF37_RS10770 (QQF37_10770) comGA 2280776..2281846 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  QQF37_RS10775 (QQF37_10775) - 2282043..2282993 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=841054 QQF37_RS10750 WP_032874016.1 2278714..2279028(-) (comGE) [Bacillus velezensis strain MC2S-6]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=841054 QQF37_RS10750 WP_032874016.1 2278714..2279028(-) (comGE) [Bacillus velezensis strain MC2S-6]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481