Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   LLUL007_RS05470 Genome accession   NZ_CP126569
Coordinates   1044946..1045497 (+) Length   183 a.a.
NCBI ID   WP_058221563.1    Uniprot ID   -
Organism   Lactococcus cremoris strain UL007     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1035019..1075337 1044946..1045497 within 0


Gene organization within MGE regions


Location: 1035019..1075337
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUL007_RS05385 (LLUL007_05380) - 1035019..1035354 (+) 336 WP_011676389.1 putative DNA-binding protein -
  LLUL007_RS05395 (LLUL007_05390) - 1035973..1037055 (-) 1083 WP_396426263.1 tyrosine-type recombinase/integrase -
  LLUL007_RS05400 (LLUL007_05395) - 1037240..1037827 (-) 588 WP_396426264.1 hypothetical protein -
  LLUL007_RS05405 (LLUL007_05400) - 1037837..1038364 (-) 528 WP_396426265.1 helix-turn-helix domain-containing protein -
  LLUL007_RS05410 (LLUL007_05405) - 1038627..1038797 (+) 171 WP_211753017.1 putative transcriptional regulator -
  LLUL007_RS05415 (LLUL007_05410) - 1038858..1039319 (-) 462 WP_396426266.1 hypothetical protein -
  LLUL007_RS05420 (LLUL007_05415) istB 1039395..1040153 (-) 759 WP_003331414.1 IS21-like element IS712 family helper ATPase IstB -
  LLUL007_RS05425 (LLUL007_05420) istA 1040165..1041388 (-) 1224 WP_347450350.1 IS21-like element IS712 family transposase -
  LLUL007_RS05430 (LLUL007_05425) - 1041550..1041900 (+) 351 WP_396426267.1 helix-turn-helix domain-containing protein -
  LLUL007_RS05435 (LLUL007_05430) - 1041915..1042658 (+) 744 WP_396426268.1 ORF6C domain-containing protein -
  LLUL007_RS05440 (LLUL007_05435) - 1042671..1042961 (+) 291 WP_023188819.1 phage protein -
  LLUL007_RS05445 (LLUL007_05440) - 1043028..1043234 (+) 207 WP_021214423.1 hypothetical protein -
  LLUL007_RS05450 (LLUL007_05445) - 1043227..1043604 (-) 378 WP_396426269.1 DUF2513 domain-containing protein -
  LLUL007_RS05455 (LLUL007_05450) - 1043709..1043945 (+) 237 WP_015967983.1 DUF1408 domain-containing protein -
  LLUL007_RS05460 (LLUL007_05455) - 1044043..1044432 (+) 390 WP_396426270.1 hypothetical protein -
  LLUL007_RS05465 (LLUL007_05460) - 1044441..1044932 (+) 492 WP_050499054.1 ERF family protein -
  LLUL007_RS05470 (LLUL007_05465) ssb 1044946..1045497 (+) 552 WP_058221563.1 single-stranded DNA-binding protein Machinery gene
  LLUL007_RS05475 (LLUL007_05470) - 1045630..1046406 (+) 777 WP_014572166.1 phage replisome organiser protein -
  LLUL007_RS05480 (LLUL007_05475) - 1046425..1047300 (+) 876 WP_396426272.1 DnaA ATPase domain-containing protein -
  LLUL007_RS05485 (LLUL007_05480) - 1047297..1047461 (+) 165 WP_396426273.1 hypothetical protein -
  LLUL007_RS05490 (LLUL007_05485) - 1047451..1047840 (+) 390 WP_396426275.1 RusA family crossover junction endodeoxyribonuclease -
  LLUL007_RS05495 (LLUL007_05490) - 1047843..1048082 (+) 240 WP_396426276.1 DUF1031 domain-containing protein -
  LLUL007_RS05500 (LLUL007_05495) - 1048191..1048370 (+) 180 WP_015966806.1 DUF1497 domain-containing protein -
  LLUL007_RS05505 (LLUL007_05500) - 1048360..1048929 (+) 570 WP_396426277.1 DUF658 family protein -
  LLUL007_RS05510 (LLUL007_05505) - 1048983..1049342 (+) 360 WP_396426278.1 hypothetical protein -
  LLUL007_RS05515 (LLUL007_05510) - 1049335..1049922 (+) 588 WP_396426279.1 DUF1642 domain-containing protein -
  LLUL007_RS05520 (LLUL007_05515) - 1049919..1050083 (+) 165 WP_396426280.1 hypothetical protein -
  LLUL007_RS05525 (LLUL007_05520) dut 1050080..1050499 (+) 420 WP_396426281.1 dUTP diphosphatase -
  LLUL007_RS05530 (LLUL007_05525) - 1050502..1051068 (+) 567 WP_396426282.1 hypothetical protein -
  LLUL007_RS05535 (LLUL007_05530) - 1051061..1051330 (+) 270 WP_396426283.1 hypothetical protein -
  LLUL007_RS05540 (LLUL007_05535) - 1051320..1051640 (+) 321 WP_396426284.1 hypothetical protein -
  LLUL007_RS05545 (LLUL007_05540) - 1051808..1052038 (+) 231 WP_019291456.1 hypothetical protein -
  LLUL007_RS05550 (LLUL007_05545) - 1052035..1052205 (+) 171 WP_396426285.1 DUF1660 domain-containing protein -
  LLUL007_RS05555 (LLUL007_05550) - 1052386..1052571 (+) 186 WP_396426286.1 hypothetical protein -
  LLUL007_RS05560 (LLUL007_05555) - 1052960..1053232 (+) 273 WP_396426287.1 hypothetical protein -
  LLUL007_RS05565 (LLUL007_05560) - 1053234..1053482 (+) 249 WP_396426288.1 hypothetical protein -
  LLUL007_RS05570 (LLUL007_05565) - 1053539..1054429 (+) 891 WP_015082326.1 IS982-like element IS982B family transposase -
  LLUL007_RS05575 (LLUL007_05570) - 1054691..1054990 (+) 300 WP_017864643.1 hypothetical protein -
  LLUL007_RS05580 (LLUL007_05575) - 1055039..1055338 (+) 300 WP_396426289.1 HNH endonuclease -
  LLUL007_RS05585 (LLUL007_05580) - 1055480..1056073 (+) 594 WP_396426290.1 P27 family phage terminase small subunit -
  LLUL007_RS05590 (LLUL007_05585) - 1056070..1057809 (+) 1740 WP_396426291.1 terminase large subunit domain-containing protein -
  LLUL007_RS05600 (LLUL007_05595) - 1058420..1059613 (+) 1194 WP_396426292.1 phage portal protein -
  LLUL007_RS05605 (LLUL007_05600) - 1059600..1060223 (+) 624 WP_396426293.1 head maturation protease, ClpP-related -
  LLUL007_RS05610 (LLUL007_05605) - 1060260..1061371 (+) 1112 WP_088792927.1 IS3-like element IS981 family transposase -
  LLUL007_RS05615 (LLUL007_05610) - 1061428..1061859 (+) 432 WP_014572749.1 hypothetical protein -
  LLUL007_RS05620 (LLUL007_05615) - 1062082..1062804 (+) 723 WP_014572748.1 epoxyqueuosine reductase QueH -
  LLUL007_RS05625 (LLUL007_05620) yoaB 1063062..1065695 (+) 2634 WP_396426294.1 cation-translocating P-type ATPase -
  LLUL007_RS05630 (LLUL007_05625) - 1065738..1066366 (-) 629 Protein_1089 glycoside hydrolase family 73 protein -
  LLUL007_RS05635 (LLUL007_05630) - 1066594..1067067 (+) 474 WP_011676368.1 glutathione peroxidase -
  LLUL007_RS05640 (LLUL007_05635) carB 1067417..1070611 (+) 3195 WP_014572744.1 carbamoyl-phosphate synthase large subunit -
  LLUL007_RS05645 (LLUL007_05640) - 1070895..1071392 (+) 498 WP_396426295.1 hypothetical protein -
  LLUL007_RS05650 (LLUL007_05645) - 1071468..1073378 (+) 1911 WP_011676365.1 hypothetical protein -
  LLUL007_RS05655 (LLUL007_05650) - 1073492..1074205 (+) 714 WP_080513958.1 WxL protein peptidoglycan domain-containing protein -
  LLUL007_RS05660 (LLUL007_05655) - 1074226..1075337 (+) 1112 WP_088792927.1 IS3-like element IS981 family transposase -

Sequence


Protein


Download         Length: 183 a.a.        Molecular weight: 20998.76 Da        Isoelectric Point: 6.4657

>NTDB_id=838730 LLUL007_RS05470 WP_058221563.1 1044946..1045497(+) (ssb) [Lactococcus cremoris strain UL007]
MINNVVLVGRLTKDVELRYTPQNQATATFSLAVSRSFKNANGERETDFINCVIWRQQAENMANFTHKGSLIGITGRIQTR
NYENQQGQRVYVTEVVADSFQLLESRSQGQQQQQQGNYNQNQNNYQNQGQQNTVQQQHNQGNYQRQPQGNYQNQQQSAQQ
RAQQPDPNFGGAPMEINDEDLPF

Nucleotide


Download         Length: 552 bp        

>NTDB_id=838730 LLUL007_RS05470 WP_058221563.1 1044946..1045497(+) (ssb) [Lactococcus cremoris strain UL007]
ATGATAAATAACGTAGTTTTAGTCGGAAGACTAACTAAAGATGTAGAACTTAGATATACTCCACAAAATCAAGCTACAGC
AACTTTCTCGCTTGCAGTGAGTCGCTCTTTCAAAAATGCCAATGGAGAACGTGAAACAGATTTTATTAACTGTGTTATCT
GGCGACAACAAGCTGAAAATATGGCAAATTTCACACATAAAGGAAGCTTGATTGGTATCACTGGTAGAATCCAAACTCGA
AACTATGAAAATCAACAAGGACAACGTGTTTACGTTACTGAAGTTGTTGCAGATAGTTTCCAACTTCTTGAAAGTAGAAG
CCAAGGTCAACAACAGCAACAACAAGGAAATTACAATCAAAACCAAAATAATTACCAAAATCAGGGTCAACAAAATACTG
TTCAACAGCAACATAACCAAGGTAACTACCAAAGACAACCTCAAGGTAATTATCAAAATCAACAACAATCAGCTCAACAA
AGAGCCCAACAACCTGATCCAAACTTTGGAGGTGCTCCGATGGAAATCAACGATGAAGACCTGCCATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

55.851

100

0.574

  ssbA Bacillus subtilis subsp. subtilis str. 168

53.514

100

0.541

  ssb Glaesserella parasuis strain SC1401

34.555

100

0.361