Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QPL78_RS15975 Genome accession   NZ_CP126530
Coordinates   3097674..3097814 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain Tehuacan_S4     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3092674..3102814
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QPL78_RS15950 (QPL78_15950) - 3092957..3093337 (-) 381 WP_024122679.1 hotdog fold thioesterase -
  QPL78_RS15955 (QPL78_15955) comA 3093355..3093999 (-) 645 WP_101864137.1 two-component system response regulator ComA Regulator
  QPL78_RS15960 (QPL78_15960) comP 3094080..3096386 (-) 2307 WP_059292643.1 histidine kinase Regulator
  QPL78_RS15965 (QPL78_15965) comX 3096402..3096623 (-) 222 WP_059292642.1 competence pheromone ComX -
  QPL78_RS15970 (QPL78_15970) - 3096620..3097489 (-) 870 WP_101864136.1 polyprenyl synthetase family protein -
  QPL78_RS15975 (QPL78_15975) degQ 3097674..3097814 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  QPL78_RS15980 (QPL78_15980) - 3098275..3098643 (+) 369 WP_024122684.1 hypothetical protein -
  QPL78_RS15985 (QPL78_15985) - 3098619..3099848 (-) 1230 WP_024122685.1 EAL and HDOD domain-containing protein -
  QPL78_RS15990 (QPL78_15990) - 3099984..3101453 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  QPL78_RS15995 (QPL78_15995) - 3101469..3102020 (-) 552 WP_044158950.1 isochorismatase family cysteine hydrolase -
  QPL78_RS16000 (QPL78_16000) - 3102117..3102515 (-) 399 WP_095713979.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=838511 QPL78_RS15975 WP_024122683.1 3097674..3097814(-) (degQ) [Bacillus halotolerans strain Tehuacan_S4]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=838511 QPL78_RS15975 WP_024122683.1 3097674..3097814(-) (degQ) [Bacillus halotolerans strain Tehuacan_S4]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978