Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QNM98_RS15375 Genome accession   NZ_CP126226
Coordinates   3093205..3093345 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain B31     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3088205..3098345
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNM98_RS15350 (QNM98_15350) - 3088502..3088885 (-) 384 WP_053574130.1 hotdog fold thioesterase -
  QNM98_RS15355 (QNM98_15355) comA 3088907..3089551 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  QNM98_RS15360 (QNM98_15360) comP 3089632..3091935 (-) 2304 WP_284064747.1 histidine kinase Regulator
  QNM98_RS15365 (QNM98_15365) comX 3091955..3092134 (-) 180 WP_306383677.1 competence pheromone ComX -
  QNM98_RS15370 (QNM98_15370) comQ 3092088..3093074 (-) 987 WP_269195024.1 class 1 isoprenoid biosynthesis enzyme Regulator
  QNM98_RS15375 (QNM98_15375) degQ 3093205..3093345 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  QNM98_RS15380 (QNM98_15380) - 3093811..3094152 (+) 342 WP_015418107.1 hypothetical protein -
  QNM98_RS15385 (QNM98_15385) - 3094159..3095382 (-) 1224 WP_015418108.1 EAL and HDOD domain-containing protein -
  QNM98_RS15390 (QNM98_15390) - 3095512..3096978 (-) 1467 WP_015418109.1 nicotinate phosphoribosyltransferase -
  QNM98_RS15395 (QNM98_15395) - 3096996..3097547 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  QNM98_RS15400 (QNM98_15400) - 3097644..3098042 (-) 399 WP_003152031.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=837205 QNM98_RS15375 WP_003152043.1 3093205..3093345(-) (degQ) [Bacillus velezensis strain B31]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=837205 QNM98_RS15375 WP_003152043.1 3093205..3093345(-) (degQ) [Bacillus velezensis strain B31]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891