Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   QNH19_RS12010 Genome accession   NZ_CP126104
Coordinates   2485420..2485857 (-) Length   145 a.a.
NCBI ID   WP_283886857.1    Uniprot ID   -
Organism   Bacillus velezensis strain MB7_B11     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2480420..2490857
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH19_RS11960 (QNH19_11960) sinI 2480804..2480977 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  QNH19_RS11965 (QNH19_11965) sinR 2481011..2481346 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QNH19_RS11970 (QNH19_11970) - 2481394..2482179 (-) 786 WP_007408329.1 TasA family protein -
  QNH19_RS11975 (QNH19_11975) - 2482244..2482828 (-) 585 WP_015240205.1 signal peptidase I -
  QNH19_RS11980 (QNH19_11980) tapA 2482800..2483471 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  QNH19_RS11985 (QNH19_11985) - 2483730..2484059 (+) 330 WP_080130387.1 DUF3889 domain-containing protein -
  QNH19_RS11990 (QNH19_11990) - 2484099..2484278 (-) 180 WP_003153093.1 YqzE family protein -
  QNH19_RS11995 (QNH19_11995) comGG 2484335..2484712 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  QNH19_RS12000 (QNH19_12000) comGF 2484713..2485213 (-) 501 WP_254895460.1 competence type IV pilus minor pilin ComGF -
  QNH19_RS12005 (QNH19_12005) comGE 2485122..2485436 (-) 315 WP_080130386.1 competence type IV pilus minor pilin ComGE Machinery gene
  QNH19_RS12010 (QNH19_12010) comGD 2485420..2485857 (-) 438 WP_283886857.1 competence type IV pilus minor pilin ComGD Machinery gene
  QNH19_RS12015 (QNH19_12015) comGC 2485847..2486155 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  QNH19_RS12020 (QNH19_12020) comGB 2486160..2487197 (-) 1038 WP_283886859.1 competence type IV pilus assembly protein ComGB Machinery gene
  QNH19_RS12025 (QNH19_12025) comGA 2487184..2488254 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  QNH19_RS12030 (QNH19_12030) - 2488447..2489397 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  QNH19_RS12035 (QNH19_12035) - 2489543..2490844 (+) 1302 WP_007408318.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16288.81 Da        Isoelectric Point: 10.2186

>NTDB_id=836104 QNH19_RS12010 WP_283886857.1 2485420..2485857(-) (comGD) [Bacillus velezensis strain MB7_B11]
MNNNRRTENGFTLLESLIVLSLASVLLMVLFTTVPPAYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGKIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=836104 QNH19_RS12010 WP_283886857.1 2485420..2485857(-) (comGD) [Bacillus velezensis strain MB7_B11]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GATGGTTTTGTTCACGACGGTTCCGCCGGCCTACACCCACCTTGCCGTGCGGCAAAAAACAGAGCAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAAGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.849

100

0.572