Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QNH19_RS11960 Genome accession   NZ_CP126104
Coordinates   2480804..2480977 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain MB7_B11     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2475804..2485977
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH19_RS11945 (QNH19_11945) gcvT 2476617..2477717 (-) 1101 WP_283886845.1 glycine cleavage system aminomethyltransferase GcvT -
  QNH19_RS11950 (QNH19_11950) - 2478141..2479811 (+) 1671 WP_063094778.1 SNF2-related protein -
  QNH19_RS11955 (QNH19_11955) - 2479833..2480627 (+) 795 WP_014418368.1 YqhG family protein -
  QNH19_RS11960 (QNH19_11960) sinI 2480804..2480977 (+) 174 WP_003153105.1 anti-repressor SinI family protein Regulator
  QNH19_RS11965 (QNH19_11965) sinR 2481011..2481346 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  QNH19_RS11970 (QNH19_11970) - 2481394..2482179 (-) 786 WP_007408329.1 TasA family protein -
  QNH19_RS11975 (QNH19_11975) - 2482244..2482828 (-) 585 WP_015240205.1 signal peptidase I -
  QNH19_RS11980 (QNH19_11980) tapA 2482800..2483471 (-) 672 WP_031378945.1 amyloid fiber anchoring/assembly protein TapA -
  QNH19_RS11985 (QNH19_11985) - 2483730..2484059 (+) 330 WP_080130387.1 DUF3889 domain-containing protein -
  QNH19_RS11990 (QNH19_11990) - 2484099..2484278 (-) 180 WP_003153093.1 YqzE family protein -
  QNH19_RS11995 (QNH19_11995) comGG 2484335..2484712 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  QNH19_RS12000 (QNH19_12000) comGF 2484713..2485213 (-) 501 WP_254895460.1 competence type IV pilus minor pilin ComGF -
  QNH19_RS12005 (QNH19_12005) comGE 2485122..2485436 (-) 315 WP_080130386.1 competence type IV pilus minor pilin ComGE Machinery gene
  QNH19_RS12010 (QNH19_12010) comGD 2485420..2485857 (-) 438 WP_283886857.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=836100 QNH19_RS11960 WP_003153105.1 2480804..2480977(+) (sinI) [Bacillus velezensis strain MB7_B11]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=836100 QNH19_RS11960 WP_003153105.1 2480804..2480977(+) (sinI) [Bacillus velezensis strain MB7_B11]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702