Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   QNH19_RS01985 Genome accession   NZ_CP126104
Coordinates   391696..391815 (+) Length   39 a.a.
NCBI ID   WP_003156334.1    Uniprot ID   I2C1C3
Organism   Bacillus velezensis strain MB7_B11     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 386696..396815
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH19_RS01970 (QNH19_01970) - 388308..388991 (+) 684 WP_160242544.1 response regulator transcription factor -
  QNH19_RS01975 (QNH19_01975) - 388978..390411 (+) 1434 WP_162492834.1 HAMP domain-containing sensor histidine kinase -
  QNH19_RS01980 (QNH19_01980) rapC 390564..391712 (+) 1149 WP_283887753.1 tetratricopeptide repeat protein Regulator
  QNH19_RS01985 (QNH19_01985) phrC 391696..391815 (+) 120 WP_003156334.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  QNH19_RS01990 (QNH19_01990) - 391964..392059 (-) 96 WP_012116800.1 YjcZ family sporulation protein -
  QNH19_RS01995 (QNH19_01995) - 392154..393518 (-) 1365 WP_136396097.1 aspartate kinase -
  QNH19_RS02000 (QNH19_02000) ceuB 393932..394885 (+) 954 WP_059366593.1 ABC transporter permease Machinery gene
  QNH19_RS02005 (QNH19_02005) - 394875..395822 (+) 948 WP_007410274.1 iron chelate uptake ABC transporter family permease subunit -
  QNH19_RS02010 (QNH19_02010) - 395816..396574 (+) 759 WP_063096189.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=836070 QNH19_RS01985 WP_003156334.1 391696..391815(+) (phrC) [Bacillus velezensis strain MB7_B11]
MKLKSKWFVICLAAAAIFTVTGAGQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=836070 QNH19_RS01985 WP_003156334.1 391696..391815(+) (phrC) [Bacillus velezensis strain MB7_B11]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGTGACAGGTGCAGGCCAGACAGA
TCAGGCTGAATTCCATGTAGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB I2C1C3

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

70

100

0.718