Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QNK06_RS13220 Genome accession   NZ_CP126097
Coordinates   2514190..2514573 (-) Length   127 a.a.
NCBI ID   WP_283933557.1    Uniprot ID   -
Organism   Bacillus subtilis strain KF24     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2509190..2519573
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK06_RS13180 (QNK06_13180) sinI 2510124..2510297 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  QNK06_RS13185 (QNK06_13185) sinR 2510331..2510666 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNK06_RS13190 (QNK06_13190) tasA 2510758..2511543 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  QNK06_RS13195 (QNK06_13195) sipW 2511608..2512180 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QNK06_RS13200 (QNK06_13200) tapA 2512164..2512925 (-) 762 WP_283933555.1 amyloid fiber anchoring/assembly protein TapA -
  QNK06_RS13205 (QNK06_13205) yqzG 2513197..2513523 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNK06_RS13210 (QNK06_13210) spoIIT 2513565..2513744 (-) 180 WP_014480252.1 YqzE family protein -
  QNK06_RS13215 (QNK06_13215) comGG 2513815..2514189 (-) 375 WP_283933556.1 ComG operon protein ComGG Machinery gene
  QNK06_RS13220 (QNK06_13220) comGF 2514190..2514573 (-) 384 WP_283933557.1 ComG operon protein ComGF Machinery gene
  QNK06_RS13225 (QNK06_13225) comGE 2514599..2514946 (-) 348 WP_283933558.1 ComG operon protein 5 Machinery gene
  QNK06_RS13230 (QNK06_13230) comGD 2514930..2515361 (-) 432 WP_283933559.1 comG operon protein ComGD Machinery gene
  QNK06_RS13235 (QNK06_13235) comGC 2515351..2515647 (-) 297 WP_014477332.1 comG operon protein ComGC Machinery gene
  QNK06_RS13240 (QNK06_13240) comGB 2515661..2516698 (-) 1038 WP_283933560.1 comG operon protein ComGB Machinery gene
  QNK06_RS13245 (QNK06_13245) comGA 2516685..2517755 (-) 1071 WP_283933561.1 competence protein ComGA Machinery gene
  QNK06_RS13250 (QNK06_13250) - 2517966..2518163 (-) 198 WP_032726162.1 hypothetical protein -
  QNK06_RS13255 (QNK06_13255) corA 2518165..2519118 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14289.40 Da        Isoelectric Point: 6.2112

>NTDB_id=835718 QNK06_RS13220 WP_283933557.1 2514190..2514573(-) (comGF) [Bacillus subtilis strain KF24]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADFVNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=835718 QNK06_RS13220 WP_283933557.1 2514190..2514573(-) (comGF) [Bacillus subtilis strain KF24]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGT
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATTTTGTAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

96.85

100

0.969