Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QNK06_RS13180 Genome accession   NZ_CP126097
Coordinates   2510124..2510297 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain KF24     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2505124..2515297
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK06_RS13165 (QNK06_13165) gcvT 2505922..2507010 (-) 1089 WP_283933554.1 glycine cleavage system aminomethyltransferase GcvT -
  QNK06_RS13170 (QNK06_13170) yqhH 2507452..2509125 (+) 1674 WP_169037820.1 SNF2-related protein -
  QNK06_RS13175 (QNK06_13175) yqhG 2509146..2509940 (+) 795 WP_032726154.1 YqhG family protein -
  QNK06_RS13180 (QNK06_13180) sinI 2510124..2510297 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  QNK06_RS13185 (QNK06_13185) sinR 2510331..2510666 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNK06_RS13190 (QNK06_13190) tasA 2510758..2511543 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  QNK06_RS13195 (QNK06_13195) sipW 2511608..2512180 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QNK06_RS13200 (QNK06_13200) tapA 2512164..2512925 (-) 762 WP_283933555.1 amyloid fiber anchoring/assembly protein TapA -
  QNK06_RS13205 (QNK06_13205) yqzG 2513197..2513523 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNK06_RS13210 (QNK06_13210) spoIIT 2513565..2513744 (-) 180 WP_014480252.1 YqzE family protein -
  QNK06_RS13215 (QNK06_13215) comGG 2513815..2514189 (-) 375 WP_283933556.1 ComG operon protein ComGG Machinery gene
  QNK06_RS13220 (QNK06_13220) comGF 2514190..2514573 (-) 384 WP_283933557.1 ComG operon protein ComGF Machinery gene
  QNK06_RS13225 (QNK06_13225) comGE 2514599..2514946 (-) 348 WP_283933558.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=835715 QNK06_RS13180 WP_014477323.1 2510124..2510297(+) (sinI) [Bacillus subtilis strain KF24]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=835715 QNK06_RS13180 WP_014477323.1 2510124..2510297(+) (sinI) [Bacillus subtilis strain KF24]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982