Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QNH30_RS16085 Genome accession   NZ_CP126082
Coordinates   3099690..3099830 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain C1_13     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3094690..3104830
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH30_RS16060 (QNH30_16060) yuxO 3095033..3095413 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  QNH30_RS16065 (QNH30_16065) comA 3095432..3096076 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  QNH30_RS16070 (QNH30_16070) comP 3096157..3098457 (-) 2301 WP_041850586.1 histidine kinase Regulator
  QNH30_RS16075 (QNH30_16075) comX 3098469..3098633 (-) 165 WP_015384519.1 competence pheromone ComX -
  QNH30_RS16080 (QNH30_16080) - 3098646..3099506 (-) 861 WP_041850585.1 polyprenyl synthetase family protein -
  QNH30_RS16085 (QNH30_16085) degQ 3099690..3099830 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  QNH30_RS16090 (QNH30_16090) - 3100052..3100114 (+) 63 Protein_3100 hypothetical protein -
  QNH30_RS16095 (QNH30_16095) - 3100293..3100661 (+) 369 WP_041850584.1 hypothetical protein -
  QNH30_RS16100 (QNH30_16100) pdeH 3100637..3101866 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  QNH30_RS16105 (QNH30_16105) pncB 3102003..3103475 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  QNH30_RS16110 (QNH30_16110) pncA 3103491..3104042 (-) 552 WP_038828671.1 isochorismatase family cysteine hydrolase -
  QNH30_RS16115 (QNH30_16115) yueI 3104139..3104537 (-) 399 WP_032726794.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=834855 QNH30_RS16085 WP_003220708.1 3099690..3099830(-) (degQ) [Bacillus subtilis strain C1_13]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=834855 QNH30_RS16085 WP_003220708.1 3099690..3099830(-) (degQ) [Bacillus subtilis strain C1_13]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1