Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   QNH35_RS15855 Genome accession   NZ_CP126081
Coordinates   3035100..3035240 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain B2_10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3030100..3040240
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNH35_RS15830 (QNH35_15830) - 3030368..3030757 (-) 390 WP_265208433.1 hotdog fold thioesterase -
  QNH35_RS15835 (QNH35_15835) comA 3030781..3031422 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  QNH35_RS15840 (QNH35_15840) comP 3031503..3033812 (-) 2310 WP_217012172.1 ATP-binding protein Regulator
  QNH35_RS15845 (QNH35_15845) comX 3033870..3034037 (-) 168 WP_081311380.1 competence pheromone ComX -
  QNH35_RS15850 (QNH35_15850) - 3034034..3034948 (-) 915 WP_265208437.1 polyprenyl synthetase family protein -
  QNH35_RS15855 (QNH35_15855) degQ 3035100..3035240 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  QNH35_RS15860 (QNH35_15860) - 3035746..3036099 (+) 354 WP_113768032.1 inner spore coat protein -
  QNH35_RS15865 (QNH35_15865) - 3036130..3037356 (-) 1227 WP_106066310.1 HDOD domain-containing protein -
  QNH35_RS15870 (QNH35_15870) - 3037498..3038967 (-) 1470 WP_058013789.1 nicotinate phosphoribosyltransferase -
  QNH35_RS15875 (QNH35_15875) - 3038985..3039536 (-) 552 WP_012011112.1 isochorismatase family cysteine hydrolase -
  QNH35_RS15880 (QNH35_15880) - 3039597..3040004 (-) 408 WP_044140823.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=834777 QNH35_RS15855 WP_003213123.1 3035100..3035240(-) (degQ) [Bacillus pumilus strain B2_10]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=834777 QNH35_RS15855 WP_003213123.1 3035100..3035240(-) (degQ) [Bacillus pumilus strain B2_10]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696