Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QNK10_RS12545 Genome accession   NZ_CP125982
Coordinates   2341978..2342361 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain ZKY05     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2336978..2347361
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK10_RS12505 (QNK10_12515) sinI 2337912..2338085 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QNK10_RS12510 (QNK10_12520) sinR 2338119..2338454 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNK10_RS12515 (QNK10_12525) tasA 2338547..2339332 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  QNK10_RS12520 (QNK10_12530) sipW 2339396..2339968 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QNK10_RS12525 (QNK10_12535) tapA 2339952..2340713 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QNK10_RS12530 (QNK10_12540) yqzG 2340985..2341311 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNK10_RS12535 (QNK10_12545) spoIITA 2341353..2341532 (-) 180 WP_014480252.1 YqzE family protein -
  QNK10_RS12540 (QNK10_12550) comGG 2341603..2341977 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QNK10_RS12545 (QNK10_12555) comGF 2341978..2342361 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  QNK10_RS12550 (QNK10_12560) comGE 2342387..2342734 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  QNK10_RS12555 (QNK10_12565) comGD 2342718..2343149 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  QNK10_RS12560 (QNK10_12570) comGC 2343139..2343435 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QNK10_RS12565 (QNK10_12575) comGB 2343449..2344486 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  QNK10_RS12570 (QNK10_12580) comGA 2344473..2345543 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QNK10_RS12575 (QNK10_12585) - 2345755..2345952 (-) 198 WP_014480259.1 CBS domain-containing protein -
  QNK10_RS12580 (QNK10_12590) corA 2345954..2346907 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=833989 QNK10_RS12545 WP_014480254.1 2341978..2342361(-) (comGF) [Bacillus subtilis strain ZKY05]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=833989 QNK10_RS12545 WP_014480254.1 2341978..2342361(-) (comGF) [Bacillus subtilis strain ZKY05]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984