Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QNK10_RS12505 Genome accession   NZ_CP125982
Coordinates   2337912..2338085 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain ZKY05     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2332912..2343085
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QNK10_RS12490 (QNK10_12500) gcvT 2333711..2334799 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  QNK10_RS12495 (QNK10_12505) hepAA 2335241..2336914 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  QNK10_RS12500 (QNK10_12510) yqhG 2336935..2337729 (+) 795 WP_264379318.1 YqhG family protein -
  QNK10_RS12505 (QNK10_12515) sinI 2337912..2338085 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QNK10_RS12510 (QNK10_12520) sinR 2338119..2338454 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QNK10_RS12515 (QNK10_12525) tasA 2338547..2339332 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  QNK10_RS12520 (QNK10_12530) sipW 2339396..2339968 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QNK10_RS12525 (QNK10_12535) tapA 2339952..2340713 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QNK10_RS12530 (QNK10_12540) yqzG 2340985..2341311 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QNK10_RS12535 (QNK10_12545) spoIITA 2341353..2341532 (-) 180 WP_014480252.1 YqzE family protein -
  QNK10_RS12540 (QNK10_12550) comGG 2341603..2341977 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QNK10_RS12545 (QNK10_12555) comGF 2341978..2342361 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  QNK10_RS12550 (QNK10_12560) comGE 2342387..2342734 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=833986 QNK10_RS12505 WP_003230187.1 2337912..2338085(+) (sinI) [Bacillus subtilis strain ZKY05]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=833986 QNK10_RS12505 WP_003230187.1 2337912..2338085(+) (sinI) [Bacillus subtilis strain ZKY05]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1