Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   QM970_RS12575 Genome accession   NZ_CP125980
Coordinates   2344776..2345159 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain ZKY03     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2339776..2350159
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QM970_RS12535 (QM970_12530) sinI 2340710..2340883 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QM970_RS12540 (QM970_12535) sinR 2340917..2341252 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QM970_RS12545 (QM970_12540) tasA 2341345..2342130 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  QM970_RS12550 (QM970_12545) sipW 2342194..2342766 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QM970_RS12555 (QM970_12550) tapA 2342750..2343511 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QM970_RS12560 (QM970_12555) yqzG 2343783..2344109 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QM970_RS12565 (QM970_12560) spoIITA 2344151..2344330 (-) 180 WP_014480252.1 YqzE family protein -
  QM970_RS12570 (QM970_12565) comGG 2344401..2344775 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QM970_RS12575 (QM970_12570) comGF 2344776..2345159 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  QM970_RS12580 (QM970_12575) comGE 2345185..2345532 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  QM970_RS12585 (QM970_12580) comGD 2345516..2345947 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  QM970_RS12590 (QM970_12585) comGC 2345937..2346233 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  QM970_RS12595 (QM970_12590) comGB 2346247..2347284 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  QM970_RS12600 (QM970_12595) comGA 2347271..2348341 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  QM970_RS12605 (QM970_12600) - 2348553..2348750 (-) 198 WP_014480259.1 CBS domain-containing protein -
  QM970_RS12610 (QM970_12605) corA 2348752..2349705 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=833834 QM970_RS12575 WP_014480254.1 2344776..2345159(-) (comGF) [Bacillus subtilis strain ZKY03]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=833834 QM970_RS12575 WP_014480254.1 2344776..2345159(-) (comGF) [Bacillus subtilis strain ZKY03]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984