Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   QM970_RS12535 Genome accession   NZ_CP125980
Coordinates   2340710..2340883 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain ZKY03     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2335710..2345883
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QM970_RS12520 (QM970_12515) gcvT 2336509..2337597 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  QM970_RS12525 (QM970_12520) hepAA 2338039..2339712 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  QM970_RS12530 (QM970_12525) yqhG 2339733..2340527 (+) 795 WP_264379318.1 YqhG family protein -
  QM970_RS12535 (QM970_12530) sinI 2340710..2340883 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  QM970_RS12540 (QM970_12535) sinR 2340917..2341252 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QM970_RS12545 (QM970_12540) tasA 2341345..2342130 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  QM970_RS12550 (QM970_12545) sipW 2342194..2342766 (-) 573 WP_003230181.1 signal peptidase I SipW -
  QM970_RS12555 (QM970_12550) tapA 2342750..2343511 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QM970_RS12560 (QM970_12555) yqzG 2343783..2344109 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  QM970_RS12565 (QM970_12560) spoIITA 2344151..2344330 (-) 180 WP_014480252.1 YqzE family protein -
  QM970_RS12570 (QM970_12565) comGG 2344401..2344775 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QM970_RS12575 (QM970_12570) comGF 2344776..2345159 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  QM970_RS12580 (QM970_12575) comGE 2345185..2345532 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=833831 QM970_RS12535 WP_003230187.1 2340710..2340883(+) (sinI) [Bacillus subtilis strain ZKY03]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=833831 QM970_RS12535 WP_003230187.1 2340710..2340883(+) (sinI) [Bacillus subtilis strain ZKY03]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1