Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   U1R71_RS12650 Genome accession   NZ_CP140123
Coordinates   2353859..2354032 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain SJTU2     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2348859..2359032
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U1R71_RS12635 (U1R71_12635) gcvT 2349658..2350746 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  U1R71_RS12640 (U1R71_12640) hepAA 2351188..2352861 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  U1R71_RS12645 (U1R71_12645) yqhG 2352882..2353676 (+) 795 WP_014480249.1 YqhG family protein -
  U1R71_RS12650 (U1R71_12650) sinI 2353859..2354032 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  U1R71_RS12655 (U1R71_12655) sinR 2354066..2354401 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  U1R71_RS12660 (U1R71_12660) tasA 2354494..2355279 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  U1R71_RS12665 (U1R71_12665) sipW 2355343..2355915 (-) 573 WP_003230181.1 signal peptidase I SipW -
  U1R71_RS12670 (U1R71_12670) tapA 2355899..2356660 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  U1R71_RS12675 (U1R71_12675) yqzG 2356932..2357258 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  U1R71_RS12680 (U1R71_12680) spoIITA 2357300..2357479 (-) 180 WP_014480252.1 YqzE family protein -
  U1R71_RS12685 (U1R71_12685) comGG 2357550..2357924 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  U1R71_RS12690 (U1R71_12690) comGF 2357925..2358308 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  U1R71_RS12695 (U1R71_12695) comGE 2358334..2358681 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=833762 U1R71_RS12650 WP_003230187.1 2353859..2354032(+) (sinI) [Bacillus subtilis strain SJTU2]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=833762 U1R71_RS12650 WP_003230187.1 2353859..2354032(+) (sinI) [Bacillus subtilis strain SJTU2]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1