Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   U1R71_RS12690 Genome accession   NZ_CP140123
Coordinates   2357925..2358308 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis strain SJTU2     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2352925..2363308
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  U1R71_RS12650 (U1R71_12650) sinI 2353859..2354032 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  U1R71_RS12655 (U1R71_12655) sinR 2354066..2354401 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  U1R71_RS12660 (U1R71_12660) tasA 2354494..2355279 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  U1R71_RS12665 (U1R71_12665) sipW 2355343..2355915 (-) 573 WP_003230181.1 signal peptidase I SipW -
  U1R71_RS12670 (U1R71_12670) tapA 2355899..2356660 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  U1R71_RS12675 (U1R71_12675) yqzG 2356932..2357258 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  U1R71_RS12680 (U1R71_12680) spoIITA 2357300..2357479 (-) 180 WP_014480252.1 YqzE family protein -
  U1R71_RS12685 (U1R71_12685) comGG 2357550..2357924 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  U1R71_RS12690 (U1R71_12690) comGF 2357925..2358308 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  U1R71_RS12695 (U1R71_12695) comGE 2358334..2358681 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  U1R71_RS12700 (U1R71_12700) comGD 2358665..2359096 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  U1R71_RS12705 (U1R71_12705) comGC 2359086..2359382 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  U1R71_RS12710 (U1R71_12710) comGB 2359396..2360433 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  U1R71_RS12715 (U1R71_12715) comGA 2360420..2361490 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  U1R71_RS12720 (U1R71_12720) - 2361702..2361899 (-) 198 WP_014480259.1 CBS domain-containing protein -
  U1R71_RS12725 (U1R71_12725) corA 2361901..2362854 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=833765 U1R71_RS12690 WP_014480254.1 2357925..2358308(-) (comGF) [Bacillus subtilis strain SJTU2]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=833765 U1R71_RS12690 WP_014480254.1 2357925..2358308(-) (comGF) [Bacillus subtilis strain SJTU2]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984