Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   QMY17_RS09455 Genome accession   NZ_CP125812
Coordinates   1782859..1783032 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain N3378-3At     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1777859..1788032
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  QMY17_RS09410 comGE 1778210..1778557 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  QMY17_RS09415 comGF 1778583..1778966 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  QMY17_RS09420 comGG 1778967..1779341 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  QMY17_RS09425 spoIITA 1779412..1779591 (+) 180 WP_014480252.1 YqzE family protein -
  QMY17_RS09430 yqzG 1779633..1779959 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  QMY17_RS09435 tapA 1780231..1780992 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  QMY17_RS09440 sipW 1780976..1781548 (+) 573 WP_003230181.1 signal peptidase I SipW -
  QMY17_RS09445 tasA 1781612..1782397 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  QMY17_RS09450 sinR 1782490..1782825 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  QMY17_RS09455 sinI 1782859..1783032 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  QMY17_RS09460 yqhG 1783215..1784009 (-) 795 WP_014480249.1 YqhG family protein -
  QMY17_RS09465 hepAA 1784030..1785703 (-) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  QMY17_RS09470 gcvT 1786145..1787233 (+) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=832945 QMY17_RS09455 WP_003230187.1 1782859..1783032(-) (sinI) [Bacillus subtilis strain N3378-3At]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=832945 QMY17_RS09455 WP_003230187.1 1782859..1783032(-) (sinI) [Bacillus subtilis strain N3378-3At]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1